KEGG   Streptomyces cattleya NRRL 8057: SCAT_3921Help
Entry
SCAT_3921         CDS       T01646                                 

Gene name
ispH
Definition
4-hydroxy-3-methylbut-2-enyl diphosphate reductase
Orthology
K03527  
4-hydroxy-3-methylbut-2-enyl diphosphate reductase [EC:1.17.1.2]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:sct00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4196528..4197430)
Genome map
AA seq 300 aa AA seqDB search
MITVEKALEQYGAPIYVRKEIVHNKYVVRTLEKKGAIFVDETEEVPEGSIVIFSAHGVAP
VVHEEAAQRKLASIDATCPLVTKVHKEAQRFAREDYDILLIGHEGHEEVIGTMGEAPDRI
HLVDGPEDVASVRVRDENKLVWLSQTTLSVDETMETVEKLQERFPALVSPPSDDICYATQ
NRQLAVKRMGADAELVIVVGSRNSSNSKRLVEVALQAGAGDAHLVDFADEIDEAWLEGVT
TVGVTSGASVPEVLVQGVLEWLAERGYADVEIIRAAEESIQFSLPKELRRDLRAETAAAE
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaccgtcgagaaggccctggagcagtacggggcaccgatctacgtgcgcaaggag
atcgtccacaacaagtacgtggtgcggacgctggagaagaagggcgcgatcttcgtcgac
gagacggaggaggtgccggagggctccatcgtgatcttctcggcgcacggcgtcgcgccg
gtggtccacgaggaggccgcgcagcgcaagctcgcctccatcgacgccacctgcccgctg
gtgaccaaggtgcacaaggaggcccagcggttcgcccgcgaggactacgacatcctgctg
atcgggcacgagggccacgaggaggtcatcggcacgatgggcgaggcgccggaccgcatc
cacctggtggacggcccggaggacgtggcctcggtgcgggtgcgggacgagaacaagctg
gtgtggctctcccagaccacgctgtcggtggacgagaccatggagacggtggagaagctc
caggagcgtttcccggccctggtcagcccgcccagcgacgacatctgctacgccacccag
aaccgccagctggcggtcaagcggatgggcgccgacgccgagctggtgatcgtggtcggc
tcgcgcaactcctccaactccaagcggctggtggaggtcgccctccaggccggggccggc
gacgcccacctggtggacttcgccgacgagatcgacgaggcgtggctggagggggtcacc
acggtcggcgtcacctcgggcgcctcggtgccggaggtgctggtgcagggcgtgctggag
tggctggccgagcgcggttacgcggacgtggagatcatccgggccgccgaggagagcatc
cagttctcgctccccaaggagctgcgccgggatctgcgggcggagaccgccgccgcggag
tga

DBGET integrated database retrieval system