KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_3998Help
Entry
SCAT_3998         CDS       T01646                                 

Gene name
folP
Definition
(GenBank) Dihydropteroate synthase 2
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
sct00790  Folate biosynthesis
sct01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SCAT_3998 (folP)
Enzymes [BR:sct01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SCAT_3998 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: CCB76694
UniProt: F8K3N2
Position
complement(4277923..4278783)
Genome map
AA seq 286 aa AA seqDB search
MLRLGKREFGDHEPVIMAIVNRTPDSFYDQGATFADEAALARVDRAVAEGAAIIDIGGVK
AGPGEEVTTEEEIRRIVPFVAEVRERHPDVVISVDTWRHEVGEAVCAVGADLLNDAWGGV
DPHLAEVAARHRVGLVCTHAGGAEPRTRPHRVGYEDVMADILRVTLGLAQRAAELGVPRD
AILIDPGHDFGKNTRHSLEATRRLGEMVGTGWPVLVSLSNKDFVGETLDRPVKERLLGTL
ATTAVSAWLGARVYRVHEVAETRQVLDMVASIAGHRPPAVARRGLA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggctgggcaagcgcgaattcggcgatcacgagccggtgatcatggcgatcgtg
aaccgtaccccggactccttctacgaccaaggtgccaccttcgccgacgaggcggcgctg
gcccgggtcgaccgggcggtcgccgagggggccgccatcatcgacatcggcggggtgaag
gccggacccggcgaggaggtcaccaccgaggaggagatccgccggatcgtgcccttcgtc
gccgaggtccgcgagcgccacccggacgtggtgatcagcgtggacacctggcgccacgag
gtcggcgaggcggtctgcgcggtcggcgccgacctgctcaacgacgcctggggcggggtc
gatccgcacctcgccgaggtcgccgcccggcaccgggtggggctggtgtgcacccacgcc
ggcggcgccgagccgcggacccgcccgcaccgggtggggtacgaggacgtgatggccgac
atcctgcgggtgacgctgggcctggcgcagcgggcggccgaactgggggtgccgcgggac
gccatcctgatcgacccggggcacgacttcggcaagaacacccggcactcgctggaggcg
acccggcggctcggcgagatggtgggcaccggctggccggtgctggtgtccttgtccaac
aaggacttcgtcggcgagacgctggaccgcccggtcaaggagcggctgctgggcacgctg
gccaccaccgcggtctcggcgtggctgggggcccgggtctaccgggtgcacgaggtcgcc
gagacccggcaggtgctcgacatggtggcctccatcgccggccaccggccccccgcggtg
gcccgcagggggctggcctga

DBGET integrated database retrieval system