KEGG   Streptomyces cattleya NRRL 8057: SCAT_4094Help
Entry
SCAT_4094         CDS       T01646                                 

Definition
sugar hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SCAT_4094
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    SCAT_4094
Enzymes [BR:sct01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SCAT_4094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4383691..4385217
Genome map
AA seq 508 aa AA seqDB search
MTTTAPATLTRDALAVLQPGFTGTTPPDWVLRRLGEGLGSVALFARNIESPEQVTALTAR
LRAESPELIVAADEEGGDVTRLEASTGSSFPGNHALGAVDDPGLTRAVARELGRRLAACG
VNLDWAPSADVNSDPGNPVIGVRSFGADPALVARHTAAYVQGLQEAGVAACTKHFPGHGD
TDVDSHHDLPRVDADLATLHARELVPFRAAVAAGSKAVMSAHILLPALDPDLPATLSPAA
LTGLLRAPADRGGLGFDGLIATDAVEMAAISARYGIERGTVLALAAGADAICVGGGLADE
GTVLRLRDALVAAVRGGELAEERLADAAARVRALGAWARRQAGAAVAADPEIGLTAARRA
LRITRAGEPPAPGGPVHVAALTPVANIAVGDVTPWGVGAELARLLPGTATATYREADLAA
SGLPALVANVLRSAADRRIVIVVRDIHRHRWMADTVHALLAARPDAVVVEMGVPQAPPLG
ALHIATHGAARVCGRAAAEVIAGKDAGR
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccacggcgcccgccaccctcacccgcgacgcgctcgccgtcctccagcccggc
ttcaccggcaccaccccgcccgactgggtgctgcgccggctcggcgaggggctgggctcg
gtcgccctgttcgcccgcaacatcgaaagccccgagcaggtgaccgcgctcaccgcccgg
ctgcgcgccgagtccccggagctgatcgtggcggccgacgaggagggcggcgacgtcacc
cggctggaggcttccaccggctcctccttccccggcaaccacgccctcggcgcggtggac
gaccccgggctgacccgggcggtcgcccgcgaactcggccgccggctcgccgcgtgcggg
gtcaacctcgactgggcgccctccgccgacgtcaactccgaccccggcaaccccgtcatc
ggggtgcgctccttcggcgccgaccccgcgctggtcgcccggcacaccgccgcctacgtc
caggggctccaggaggccggggtggccgcctgtaccaagcacttccccggccacggcgac
accgacgtcgactcccaccacgacctgccgcgcgtcgacgccgacctggccacgctgcac
gcccgcgaactggtcccgttccgcgccgcggtggccgccgggagcaaggccgtgatgagc
gcccacatcctgctccccgcgctcgaccccgacctgcccgccacgctcagcccggccgcc
ctgaccggtctgctgcgcgcccccgccgaccgcggcggcctcggcttcgacgggctgatc
gccaccgacgcggtggagatggccgccatctcggcccgttacggcatcgaacgcggcacc
gtgctggcgctcgccgcgggcgccgacgccatctgcgtgggcggcggcctcgccgacgag
gggacggtgctgcggctgcgggacgccctggtggccgcggtacgcggcggtgagctggcc
gaggagcgcctcgccgacgccgccgcccgggtccgcgcgctgggcgcctgggcccgccgc
caggccggcgccgcggtggccgccgacccggagatcgggctcaccgcggcccgccgggca
ctgcggatcacccgggccggggagcctccggcgcccggcggaccggtccacgtggccgcc
ctcaccccggtggccaacatcgcggtgggcgacgtgacgccgtggggggtcggcgccgag
ctggcccggctgctgcccgggacggccaccgccacgtaccgggaggccgacctggcggca
agcggtctgcccgccttggtggcaaatgtgctccggtcggcggcggaccgtaggatcgtc
atcgtggttcgcgacatccaccggcaccggtggatggctgacaccgtgcacgccctgctg
gccgccaggccggatgccgtcgtcgtggagatgggcgtgccgcaggcacctccgctcgga
gcgctgcacatcgcgacccacggcgcggcgcgcgtgtgcgggcgggcagccgcggaagtc
atcgccggcaaggacgccggtcgctga

DBGET integrated database retrieval system