KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_4175Help
Entry
SCAT_4175         CDS       T01646                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
sct00260  Glycine, serine and threonine metabolism
sct00750  Vitamin B6 metabolism
sct01100  Metabolic pathways
sct01110  Biosynthesis of secondary metabolites
sct01120  Microbial metabolism in diverse environments
sct01230  Biosynthesis of amino acids
Module
sct_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCAT_4175 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SCAT_4175 (thrC)
Enzymes [BR:sct01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SCAT_4175 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP ACP_syn_III_C PK_C
Motif
Other DBs
NCBI-ProteinID: CCB76871
Position
4469997..4471061
Genome map
AA seq 354 aa AA seqDB search
MSGTHQWRGIIEEYRDRLPVTAETPVVTLLEGGTPLVPAQLLSERTGCDVHLKVEGANPT
GSFKDRGMTMAITRAKEEGAQAVICASTGNTSASAAGYAVRAGMVCAVLVPQGKIALGKM
GQALVHGARILQVDGNFDDCLELARGLSDKYPVALVNSVNPVRIEGQKTAAFEIVDALGD
APDIHVLPVGNAGNITAYWKGYREYAADGVSTRTPRMWGFQASGAAPIVKGEPVRDPQTI
ATAIRIGNPASWAFAEAARDESGGLIEAVTDRQILAAYRLLAAREGVFVEPASAASVAGL
LKAAEEGRLDPGQRVVCTVTGNGLKDPDWAVAGAPQPITVPVDADAAAERLGLV
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcacccaccagtggcggggcatcatcgaggagtaccgggaccggcttccggtg
accgccgagacccccgtggtcacgctgctggagggtggcaccccgctcgttcccgcccag
ctgctgtccgaacggaccggctgtgacgtccacttgaaggtcgagggggccaaccccacc
ggttccttcaaggaccgcggcatgacgatggccatcacccgggccaaggaggagggcgcc
caggcggtcatctgcgcctccaccggcaacacctcggcctcggccgccgggtacgcggta
cgggccgggatggtctgcgcggtgctggtgccgcagggcaagatcgcgctgggcaagatg
ggccaggcgctggtgcacggcgcccggatcctccaggtcgacggcaacttcgacgactgc
ctggagctggcccgcgggctgagcgacaagtacccggtggcgctggtcaactcggtcaac
ccggtgcgcatcgagggccagaagaccgccgcgttcgagatcgtggacgcgctcggggac
gcccccgacatccacgtcctcccggtgggcaacgccggcaacatcacggcgtactggaag
ggttaccgcgagtacgcggcggacggcgtgtccacccgcaccccgcggatgtgggggttc
caggcgtccggcgcggcgccgatcgtcaagggcgagccggtgcgcgacccgcagaccatc
gccaccgccatccgcatcggcaacccggcctcctgggcgttcgcggaggccgcgcgggac
gagtccggcggcctcatcgaagcggtgaccgaccgtcagatccttgccgcctaccggctg
ttggccgcgcgcgagggcgtcttcgtggagcccgcgtcggcggcctcggtggccggactg
ctcaaggcggccgaggagggccggctcgacccgggccagcgcgtggtgtgcacggtgacc
ggaaacggcctgaaggaccccgactgggcggtggccggcgccccgcagccgatcaccgtc
ccggtcgacgccgacgccgccgccgaacgcctcggtctggtgtaa

DBGET integrated database retrieval system