KEGG   Streptomyces cattleya NRRL 8057: SCAT_4175Help
Entry
SCAT_4175         CDS       T01646                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCAT_4175 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCAT_4175 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SCAT_4175 (thrC)
Enzymes [BR:sct01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SCAT_4175 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4469997..4471061
Genome map
AA seq 354 aa AA seqDB search
MSGTHQWRGIIEEYRDRLPVTAETPVVTLLEGGTPLVPAQLLSERTGCDVHLKVEGANPT
GSFKDRGMTMAITRAKEEGAQAVICASTGNTSASAAGYAVRAGMVCAVLVPQGKIALGKM
GQALVHGARILQVDGNFDDCLELARGLSDKYPVALVNSVNPVRIEGQKTAAFEIVDALGD
APDIHVLPVGNAGNITAYWKGYREYAADGVSTRTPRMWGFQASGAAPIVKGEPVRDPQTI
ATAIRIGNPASWAFAEAARDESGGLIEAVTDRQILAAYRLLAAREGVFVEPASAASVAGL
LKAAEEGRLDPGQRVVCTVTGNGLKDPDWAVAGAPQPITVPVDADAAAERLGLV
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcacccaccagtggcggggcatcatcgaggagtaccgggaccggcttccggtg
accgccgagacccccgtggtcacgctgctggagggtggcaccccgctcgttcccgcccag
ctgctgtccgaacggaccggctgtgacgtccacttgaaggtcgagggggccaaccccacc
ggttccttcaaggaccgcggcatgacgatggccatcacccgggccaaggaggagggcgcc
caggcggtcatctgcgcctccaccggcaacacctcggcctcggccgccgggtacgcggta
cgggccgggatggtctgcgcggtgctggtgccgcagggcaagatcgcgctgggcaagatg
ggccaggcgctggtgcacggcgcccggatcctccaggtcgacggcaacttcgacgactgc
ctggagctggcccgcgggctgagcgacaagtacccggtggcgctggtcaactcggtcaac
ccggtgcgcatcgagggccagaagaccgccgcgttcgagatcgtggacgcgctcggggac
gcccccgacatccacgtcctcccggtgggcaacgccggcaacatcacggcgtactggaag
ggttaccgcgagtacgcggcggacggcgtgtccacccgcaccccgcggatgtgggggttc
caggcgtccggcgcggcgccgatcgtcaagggcgagccggtgcgcgacccgcagaccatc
gccaccgccatccgcatcggcaacccggcctcctgggcgttcgcggaggccgcgcgggac
gagtccggcggcctcatcgaagcggtgaccgaccgtcagatccttgccgcctaccggctg
ttggccgcgcgcgagggcgtcttcgtggagcccgcgtcggcggcctcggtggccggactg
ctcaaggcggccgaggagggccggctcgacccgggccagcgcgtggtgtgcacggtgacc
ggaaacggcctgaaggaccccgactgggcggtggccggcgccccgcagccgatcaccgtc
ccggtcgacgccgacgccgccgccgaacgcctcggtctggtgtaa

DBGET integrated database retrieval system