KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_4247Help
Entry
SCAT_4247         CDS       T01646                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
sct00010  Glycolysis / Gluconeogenesis
sct00030  Pentose phosphate pathway
sct00051  Fructose and mannose metabolism
sct00052  Galactose metabolism
sct00680  Methane metabolism
sct01100  Metabolic pathways
sct01110  Biosynthesis of secondary metabolites
sct01120  Microbial metabolism in diverse environments
sct01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCAT_4247 (pfkA)
   00030 Pentose phosphate pathway
    SCAT_4247 (pfkA)
   00051 Fructose and mannose metabolism
    SCAT_4247 (pfkA)
   00052 Galactose metabolism
    SCAT_4247 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    SCAT_4247 (pfkA)
Enzymes [BR:sct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SCAT_4247 (pfkA)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     SCAT_4247 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase AIRC
Motif
Other DBs
NCBI-ProteinID: CCB76943
UniProt: F8JQD6
Position
4545578..4546603
Genome map
AA seq 341 aa AA seqDB search
MRIGVLTAGGDCPGLNAVIRSVTHRGITGHGDEIIGFEDGFKGLLEGRFRPLDLNSVSGI
LARGGTILGSARLERARLHEAADNVAALQADHGIDVLIPIGGEGTLTAARMLSDAGMPVV
GVPKTIDNDISATDRTFGFDTAVTVATEAIDRLKTTAESHQRVMVVEVMGRHAGWIALES
GMAGGAHAILLPERPFDPADICAMVDQRFQRGKKFAVVCVAEGAHPIEGTMPYGHGEIDP
YGHERFIGIGTRLADELAGRLGKEAKPVILGHVQRGGVPTAYDRVLATRFGWHAVEAAHK
GAFGSMTALRGNHVELVPLRDAITVLKRVPPDRMEEAESVF
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcggagttctcaccgccgggggcgactgcccggggctcaacgccgtcatccgc
tcggtgacccaccgcggcatcaccggacacggtgacgagatcatcggcttcgaggacggc
ttcaaggggctgctggaggggcggttccggccgctggacctcaactcggtcagcggcatc
ctggcccgcggcggcaccatcctcggctcggcccggctggagcgcgcccggctccacgag
gccgccgacaacgtggccgcgctccaggccgaccacgggatcgacgtcctgatccccatc
ggcggcgagggcaccctcaccgccgcccggatgctctccgacgccgggatgccggtggtg
ggggtgcccaagaccatcgacaacgacatctcggccaccgaccgcaccttcggcttcgac
accgccgtcaccgtcgccaccgaggccatcgaccggctgaagaccaccgccgagtcccac
cagcgggtgatggtggtggaggtgatgggacggcacgccggctggatcgccctggagtcc
ggcatggccggcggcgcccacgccatcctgctgcccgagcgccccttcgaccccgccgac
atctgcgccatggtcgaccagcggttccagcgcggcaagaagttcgccgtggtctgcgtc
gccgagggcgcccaccccatcgaggggacgatgccctacggccacggcgagatcgacccg
tacggccacgaacgcttcatcgggatcggcacccggctcgccgacgaactcgccggccgg
ctggggaaggaggccaagccggtcatcctcggccacgtccagcgcggcggcgtccccacc
gcgtacgacagggtgctcgccacccgcttcggctggcacgcggtggaggccgcgcacaag
ggcgccttcggcagcatgacggcgctgcgcggcaaccacgtggagctggtgccgctcagg
gacgccatcacggtgctcaagcgggtgccgccggaccggatggaggaggccgagtcggtc
ttctga

DBGET integrated database retrieval system