KEGG   Streptomyces cattleya NRRL 8057: SCAT_4284Help
Entry
SCAT_4284         CDS       T01646                                 

Gene name
asnO
Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCAT_4284 (asnO)
Enzymes [BR:sct01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     SCAT_4284 (asnO)
Peptidases [BR:sct01002]
 Cysteine Peptidases
  Family C44
   SCAT_4284 (asnO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4588021..4589907
Genome map
AA seq 628 aa AA seqDB search
MCGITGWVDFTRDLTRERHTTRAMTDTMACRGPDDEGCWSARHVALGHRRLAVIDVAGGR
QPMRTPETGPDGEPVAVISYSGEVYNFRELREELVLHGHHFRTRSDTEVVLRAYLEWGSG
FVGRLGGMYAFALWDNRTEELLLVRDRLGVKPLFHHPLDDGVLFGSEPKAILANPLATPR
LDLDGLRDALALARVPGRTPLTGVYEVKPGHLVRVRRGRLTEERYWSLRTRPHHDDLDTT
IATVRDLLTDTVDRQLVSDVPLCALLSGGLDSSALTAMAQRSLTAGRAGDAAGEVIRTFS
VDFAGYTENFTPEPFRETPDAPYVAELVRHVGTDHHEILLDTAQLVDPAVRRRVLRAWDL
PYGIGDHDPSLLLLFEAVRRRSTVALSGESADEVFGGYLWFHHPDAVRADTFPWHAVNAT
PVAEQATAFLDPALVKELALAEYVADTYREAVAEVEHLPGDDATERRMRVASHLNITRFL
PMLLDRKDRMSMAVGLEVRVPFCDHRLVSYVYNAPWAMKTFDGREKSLLRAATEQWLPPS
IVRRRKAPYPSTQDTGYDLAVNRELARIAADPASPAAPLLDRAALRAFLDRPLTGPYSMM
QRSVHTETPVRLDAWLGEYGVRLDGLTG
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
gtgtgcggaatcaccggatgggtcgacttcacccgtgatctgacccgcgaacgccacacc
acgcgggccatgaccgacacgatggcctgccgcggcccggacgacgaggggtgctggagc
gcgcgccacgtggcgctgggccaccgccgcctcgccgtcatcgacgtcgccggcggccgg
cagccgatgcgcacccccgagaccggccccgacggcgagccggtcgccgtcatcagctac
agcggcgaggtctacaacttccgcgaactgcgcgaggaactcgtcctgcacggccaccac
ttccgcacccgcagcgacaccgaggtggtgctccgcgcctacctggagtggggcagcggc
ttcgtcggacggctgggcggcatgtacgcgttcgccctgtgggacaaccgcaccgaggaa
ctcctcctggtccgcgaccggctcggcgtcaagcccctcttccaccaccccctcgacgac
ggcgtgctcttcggctccgaacccaaggccatcctcgccaacccgctggccaccccccgc
ctcgacctcgacggcctgcgcgacgccctcgccctggcccgggtccccggccgcaccccg
ctcaccggggtgtacgaggtcaaacccggccacctggtacgggtgcggcgcggccggctc
accgaggagcgctactggtcgctgcggacccggccgcaccacgacgacctcgacaccacc
atcgccaccgtgcgcgacctgctcaccgacaccgtcgaccgccaactggtctccgacgta
ccgctgtgcgccctgctctccggcggcctcgactccagcgcgctgaccgccatggcccag
cgctcgctcaccgccggacgcgccggggacgcggccggcgaggtgatccgcaccttctcg
gtcgacttcgccggctacaccgagaacttcacccccgaaccgttccgcgagacccccgac
gccccctacgtcgccgaactcgtccggcacgtcggcaccgaccaccacgagatcctgctg
gacaccgcgcaactggtcgaccccgcggtacgccgccgggtgctgcgcgcctgggacctg
ccgtacggcatcggcgaccacgacccctcgctgctgctgctcttcgaggccgtgcggcgg
cgctccacggtggcgctgtccggcgagtccgccgacgaggtcttcggcggctacctgtgg
ttccaccaccccgacgcggtccgcgccgacaccttcccctggcacgccgtcaacgccacc
cccgtcgccgagcaggccaccgccttcctcgaccccgccctcgtcaaggagctcgcgctg
gccgagtacgtcgcggacacctaccgcgaggcggtggccgaggtcgagcacctgcccggc
gacgacgcgacggagcggcggatgcgggtggcgagccacctcaacatcacccgcttcctg
cccatgctgctggaccgcaaggaccgcatgagcatggccgtcggcctggaggtacgggtg
ccgttctgcgaccaccggctggtgagctacgtctacaacgcgccctgggcgatgaagacc
ttcgacggccgggagaagagcctgctgcgcgccgccaccgagcagtggctgccgccctcg
atcgtccggcggcgcaaggccccctacccctccacccaggacaccgggtacgacctggcg
gtcaaccgcgaactggcccgcatcgccgccgacccggcgtcccccgccgcgccgctgctc
gaccgcgccgcgctgcgcgccttcctcgaccggccgctgaccgggccgtactcgatgatg
cagcgctcggtccacaccgagaccccggtacggctcgacgcgtggctcggggagtacggc
gtgcggctggacgggctcaccggctga

DBGET integrated database retrieval system