KEGG   Streptomyces cattleya NRRL 8057: SCAT_4479Help
Entry
SCAT_4479         CDS       T01646                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:sct00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4808660..4809988
Genome map
AA seq 442 aa AA seqDB search
MTVSSAPLAAPAPLADPHVLYRPQPDGDPGGPRRIVILGSTGSIGTQAIDVVLRNPDRFQ
VVALSAAGGRVRLLAEQAHRLRVRTVGIAQADKAAALREALADAYGPGEPLPEIVAGPDA
ATELAALPCDSVLNGITGSIGLAPTLAALKAGRILVLANKESLIVGGPLVTGLAAPGQVV
PVDSEHSALFQALLGGARSEVRKLIVTASGGPFRGRTRAELAGVTPRDALAHPTWDMGPV
ITINSATLVNKGLEVIEAHLLYDIPFDRIEVVVHPQSHIHSMVEFTDGSTLAQASPPDMR
MPIALGLGWPDRVPDAAPAFDWSKALTWEFYPLDDEAFPSVGLARHVGGLGGTAPAVFNA
ANEECVDAFLAGRLPFTGIVDTVAEVVEQGLTAGVVKPGTPDRGAAAGTGTSLTLADVLD
AETWARARARELATKATAEARG
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgacggtaagttccgcgcccctcgccgcgcccgcgcccctcgccgatccccacgtgctc
taccggccccagccggacggcgaccccggtggcccccggcggatcgtgatcctcggctcg
accggatcgatcggcacccaggcgatcgacgtggtgctgcgcaaccccgaccgcttccag
gtggtcgccctctccgcggccggcggccgggtacggctgctcgccgagcaggcccaccgg
ctgcgggtccggacggtcggcatcgcgcaggcggacaaggcggcggcgctgcgcgaggcg
ctggccgacgcctacgggcccggcgaaccgctgccggagatcgtggccggcccggacgcc
gccaccgagctggccgccctcccgtgcgactcggtgctcaacgggatcaccggctccatc
ggcctggcgcccaccctggccgcgctgaaggcgggccggatcctggtgctggccaacaag
gagtcgctgatcgtcggcggcccgctggtgaccgggctggccgcgccggggcaggtcgta
ccggtcgactccgagcactcggcgctcttccaggcgctgctcggcggcgcccgctccgag
gtgcgcaagctgatcgtcaccgcctccggcggcccgttccgcggccgtacccgggccgag
ctggccggggtcaccccgcgcgacgcgctggcccacccgacctgggacatggggccggtg
atcaccatcaactcggccaccctggtcaacaagggcctggaggtgatcgaggcccacctg
ctctacgacatccccttcgaccgcatcgaggtcgtggtccacccgcagtcccacatccac
tcgatggtcgagttcaccgacggctccaccctcgcccaggcgagcccgccggacatgcgc
atgcccatcgcgctgggcctcggctggcccgaccgggtgcctgacgcggcccccgccttc
gactggtccaaggcactgacctgggagttctaccccctcgacgacgaggcgttcccctcc
gtcggcctcgcccggcacgtcggcggactcggcggcaccgcccccgccgtcttcaacgcg
gccaacgaggagtgcgtggacgccttcctggccggacggctgccgttcaccgggatcgtg
gacaccgtcgccgaggtggtcgagcaggggctcacggccggggtggtcaagccgggcacc
cccgatcggggggcggcggcgggaacgggaacttccctgaccctcgcggacgtactcgat
gcggagacgtgggcacgggcccgcgcccgtgaactggcgacgaaagcgacagcggaggct
cgcggatga

DBGET integrated database retrieval system