KEGG   Streptomyces cattleya NRRL 8057: SCAT_4499Help
Entry
SCAT_4499         CDS       T01646                                 

Gene name
hex
Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SCAT_4499 (hex)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SCAT_4499 (hex)
Enzymes [BR:sct01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SCAT_4499 (hex)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4832988..4834550)
Genome map
AA seq 520 aa AA seqDB search
MAVVAAAGTGTAVQAAAPATAATVAATPLGQVVPVPASVRPHGAPFTLTPATRIDVAARS
RAARPVADYLAGLLRPATGYRLPVTAARTGGAIVLRLDGDRALGDEGYRLTSGPGGVEIR
AARPAGLFHGVQTLRQLLPAGVERHVRQHGPWTVAGGTITDVPRYSYRGAMLDVARHFFT
VPQVERYIDELALYKVNRLHLHLTDDQGWRIAVSAYPRLASYGGSTEVGGGPGGYYTKAQ
YQQIVRYAASRFLTVVPEVDMPAHTNAALASYADLNCNGVAPPLYTGTKVGFSSLCVPKD
VTYRFVAQVLREIAALTPGPYLHIGGDEAHSTKPADYVSFMDRIQPIVGKLGKTVIGWHQ
LTDAHPVRGAIAQYWGTAGNEAKVVAAAKAGTKLVMSPANHAYLDMKYNPSSPLGLNWAG
YVEVKDAYGWDPATFLRGAPASAVLGVEAPLWSETISTEDHINYLAFPRLPAIAELGWSP
AATHNWESFRVRLAAQGPRWDALGIDYYRSPQVGWPAANR
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
gtggccgtggtggccgccgccggaaccgggaccgcggtccaggcggcggcccccgccacg
gccgccacggtggcggccaccccgctgggccaggtcgttcccgtacccgcctcggtgcga
ccgcacggcgcgccgttcaccctcaccccggcgacccggatcgacgtggcggcccggtcg
cgcgcggcccggccggtcgccgactacctggccgggctgctgcggccggccaccgggtac
cggctgccggtgaccgccgcacggacgggcggcgcgatcgtcctgcggctcgacggcgac
cgggcgctcggcgacgaggggtaccggctgacgtccggcccgggcggcgtggagatccgg
gcggcgcggccggccgggctcttccacggcgtgcagacgctgcgtcagctgctgccggcc
ggcgtcgaacgccacgtacggcagcacggaccgtggaccgtggccggcggcaccatcacc
gacgtgccccgctactcctaccgtggcgcgatgctggacgtggcccggcacttcttcacc
gtgccgcaggtcgagcgctacatcgacgaactcgcgctgtacaaggtcaaccggctccac
ctgcacctcaccgacgaccagggctggcggatcgcggtctcggcgtacccacggctggcc
tcctacggcggttcgaccgaggtcggcggcgggccgggcggttactacaccaaggcgcag
taccagcagatcgtgcggtacgcggcgagccggttcctgaccgtggtgcccgaggtcgac
atgccggcgcacaccaacgcggccctcgcctcctacgccgacctcaactgcaacggggtg
gcgccgccgctgtacaccggcaccaaggtcggcttcagctcgctgtgcgtgcccaaggac
gtcacctaccgcttcgtggcccaggtgctgcgcgagatcgcggcgctgaccccggggccg
tacctgcacatcggcggggacgaggcgcactccaccaagccggccgactacgtgtcgttc
atggaccggatccagccgatcgtcggcaagctgggcaagacggtgatcggctggcaccag
ctgaccgacgcccacccggtgcggggcgccatcgcgcagtactgggggacggcgggcaac
gaggccaaggtggtggccgccgcgaaggcgggcaccaagctggtgatgtccccggccaac
cacgcgtacctggacatgaagtacaacccctcgtcgccgctgggcctcaactgggcgggg
tacgtggaggtgaaggacgcctacgggtgggatccggccacgttcctgcggggtgcgccg
gcctcggcggtgctgggcgtggaggcgccgttgtggtcggagaccatctccaccgaggac
cacatcaactacctggcgttcccgcggctgcccgccatcgccgagctgggctggtcgccg
gcggccacgcacaactgggagtcgttccgcgtccggctcgccgcgcaggggccgcgctgg
gacgccctcggcatcgactactaccgttcgccgcaggtcggttggcccgccgccaaccgc
tga

DBGET integrated database retrieval system