KEGG   Streptomyces cattleya NRRL 8057: SCAT_4689Help
Entry
SCAT_4689         CDS       T01646                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SCAT_4689
Enzymes [BR:sct01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     SCAT_4689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5058713..5060281
Genome map
AA seq 522 aa AA seqDB search
MSAARSQRPEETATPEAADGPEAPGGAAGAATLGHVVVVGGGISGLAAAHRLVTAGARVT
VLEAADRLGGKLHADEIAGVPVDLGAESMLARRPEAVALARRVGLGPDLQPPATAQAALW
TRGRLRPMPRGHVMGVPGDLQPLSASGVLSPAGLARIPLDHVLPRTEVGEDVAIGEYVAA
RLGREVVDRLVEPLLGGVYAGNSYRLSMRAAVPQLYAAARAERSLIEGVRAVQAKAASST
AQESSGRAVTGDDRAGAAAGPVFMGIAGGVGRLPLAVADACRAAGADIRTGTRVHTLRRT
ADGWRLAADGPGGRYALQADAVVLAVPGPAAARLLAAESPGAAAELSTVECAGMALITMA
FRRRDLLNAPAGSGFLVPPVDGRTIKAATFATRKWGWIDQAGPDTFVLRTSIGRHGEEAD
LAWDDTDLVRLSREDLAQAAGVTAVPVAARVTRWTEGLPQYPVGHLERTARVREHVAKLP
GLAVCGAAYDGVGIPACVATADRAADEVLATLRTAVRNDAGE
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcagcgaggtcgcaacgtcctgaggaaaccgccaccccggaagcggccgacggc
ccggaggcccccggcggcgcggccggtgccgccacgctcgggcacgtcgtggtcgtcggc
ggcggcatctccgggctcgccgccgcccaccggctggtgaccgccggtgcccgggtcacc
gtgctggaggccgccgaccggctcggcggcaaactccacgccgacgagatcgccggggtc
cccgtcgacctgggcgccgagtccatgctggcccggcgcccggaggcggtcgcgctcgcc
cggcgggtcggcctcggccccgacctccagccgccggccaccgcccaggccgcgctgtgg
acccggggccggctgcgcccgatgccgcgcggccacgtcatgggcgtccccggcgatctc
cagccgctctccgcctccggggtgctctccccggccggcctcgcccgcatccccctcgac
cacgtactcccgcgcaccgaggtcggcgaggacgtcgccatcggcgagtacgtggccgcc
cgcctcggccgcgaagtggtcgaccggctcgtcgaacccctcctcggcggcgtctacgcg
ggcaactcctaccgcctctccatgcgggccgccgtgccccagctgtacgccgccgcccgc
gccgaacgctcgctgatcgagggcgtacgggccgtccaggccaaggcggcctcctccacc
gcgcaggagtcctccggccgcgccgtcaccggggacgaccgggcgggcgccgcggccgga
ccggtcttcatgggcatcgccggcggcgtgggacggctgccgctcgcggtcgccgacgcc
tgccgcgccgcgggcgccgacatccgcaccggcacccgggtgcacaccctgcggcggacg
gccgacggctggcggctggccgcagacggccccggcggacggtacgccctccaggccgac
gccgtggtgctcgccgtccccggccccgccgcggcccggctgctcgccgccgagtcgccc
ggggcggcggccgaactgagcaccgtggagtgcgccggcatggcgctgatcaccatggcc
ttccgccgccgcgacctgctgaacgcccccgccggcagcggcttcctggtgcccccggtc
gacggccgcaccatcaaggcggccaccttcgccacccgcaagtggggctggatcgaccag
gccggcccggacaccttcgtgctgcgcacctccatcggacgccacggcgaggaggccgac
ctggcctgggacgacaccgacctggtgcggctgtcccgggaggacctggcacaggccgcc
ggggtcaccgcggtgccggtcgccgcccgggtgacccggtggaccgagggcctgccgcag
tatccggtcggccacctggagcgcaccgcgcgcgtccgcgaacacgtcgccaagctgccc
ggcctcgcggtctgcggcgccgcctacgacggcgtgggcatcccggcctgcgtcgccacc
gccgaccgcgccgccgacgaggtactggccaccctgcgcacggccgtccggaacgacgcg
ggagaatag

DBGET integrated database retrieval system