KEGG   Streptomyces cattleya NRRL 8057: SCAT_4689Help
Entry
SCAT_4689         CDS       T01646                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sct00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5058713..5060281
Genome map
AA seq 522 aa AA seqDB search
MSAARSQRPEETATPEAADGPEAPGGAAGAATLGHVVVVGGGISGLAAAHRLVTAGARVT
VLEAADRLGGKLHADEIAGVPVDLGAESMLARRPEAVALARRVGLGPDLQPPATAQAALW
TRGRLRPMPRGHVMGVPGDLQPLSASGVLSPAGLARIPLDHVLPRTEVGEDVAIGEYVAA
RLGREVVDRLVEPLLGGVYAGNSYRLSMRAAVPQLYAAARAERSLIEGVRAVQAKAASST
AQESSGRAVTGDDRAGAAAGPVFMGIAGGVGRLPLAVADACRAAGADIRTGTRVHTLRRT
ADGWRLAADGPGGRYALQADAVVLAVPGPAAARLLAAESPGAAAELSTVECAGMALITMA
FRRRDLLNAPAGSGFLVPPVDGRTIKAATFATRKWGWIDQAGPDTFVLRTSIGRHGEEAD
LAWDDTDLVRLSREDLAQAAGVTAVPVAARVTRWTEGLPQYPVGHLERTARVREHVAKLP
GLAVCGAAYDGVGIPACVATADRAADEVLATLRTAVRNDAGE
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcagcgaggtcgcaacgtcctgaggaaaccgccaccccggaagcggccgacggc
ccggaggcccccggcggcgcggccggtgccgccacgctcgggcacgtcgtggtcgtcggc
ggcggcatctccgggctcgccgccgcccaccggctggtgaccgccggtgcccgggtcacc
gtgctggaggccgccgaccggctcggcggcaaactccacgccgacgagatcgccggggtc
cccgtcgacctgggcgccgagtccatgctggcccggcgcccggaggcggtcgcgctcgcc
cggcgggtcggcctcggccccgacctccagccgccggccaccgcccaggccgcgctgtgg
acccggggccggctgcgcccgatgccgcgcggccacgtcatgggcgtccccggcgatctc
cagccgctctccgcctccggggtgctctccccggccggcctcgcccgcatccccctcgac
cacgtactcccgcgcaccgaggtcggcgaggacgtcgccatcggcgagtacgtggccgcc
cgcctcggccgcgaagtggtcgaccggctcgtcgaacccctcctcggcggcgtctacgcg
ggcaactcctaccgcctctccatgcgggccgccgtgccccagctgtacgccgccgcccgc
gccgaacgctcgctgatcgagggcgtacgggccgtccaggccaaggcggcctcctccacc
gcgcaggagtcctccggccgcgccgtcaccggggacgaccgggcgggcgccgcggccgga
ccggtcttcatgggcatcgccggcggcgtgggacggctgccgctcgcggtcgccgacgcc
tgccgcgccgcgggcgccgacatccgcaccggcacccgggtgcacaccctgcggcggacg
gccgacggctggcggctggccgcagacggccccggcggacggtacgccctccaggccgac
gccgtggtgctcgccgtccccggccccgccgcggcccggctgctcgccgccgagtcgccc
ggggcggcggccgaactgagcaccgtggagtgcgccggcatggcgctgatcaccatggcc
ttccgccgccgcgacctgctgaacgcccccgccggcagcggcttcctggtgcccccggtc
gacggccgcaccatcaaggcggccaccttcgccacccgcaagtggggctggatcgaccag
gccggcccggacaccttcgtgctgcgcacctccatcggacgccacggcgaggaggccgac
ctggcctgggacgacaccgacctggtgcggctgtcccgggaggacctggcacaggccgcc
ggggtcaccgcggtgccggtcgccgcccgggtgacccggtggaccgagggcctgccgcag
tatccggtcggccacctggagcgcaccgcgcgcgtccgcgaacacgtcgccaagctgccc
ggcctcgcggtctgcggcgccgcctacgacggcgtgggcatcccggcctgcgtcgccacc
gccgaccgcgccgccgacgaggtactggccaccctgcgcacggccgtccggaacgacgcg
ggagaatag

DBGET integrated database retrieval system