KEGG   Streptomyces cattleya NRRL 8057: SCAT_4769Help
Entry
SCAT_4769         CDS       T01646                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCAT_4769
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCAT_4769
   00620 Pyruvate metabolism
    SCAT_4769
   00640 Propanoate metabolism
    SCAT_4769
  Energy metabolism
   00680 Methane metabolism
    SCAT_4769
Enzymes [BR:sct01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SCAT_4769
Lipid biosynthesis proteins [BR:sct01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SCAT_4769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5143227..5144906
Genome map
AA seq 559 aa AA seqDB search
MAHSAATEEFRAARDFLLRHRTDYRAAYDGFRWPRPEHFNWALDWFDRIAEGNDRTALWI
AEEDGTETRHSFAELSERSDRVAGWLRARGVRAGDRIVVMLGNQSELWLTALAAMKLRAV
VIPATPLLGAADLADRVARGRARHVIVRAADTAKFASVPGDYTRIAVGGAPQGWLAYEDA
HTAGEAFTPDGPTRGDDLLMLYFTSGTTALPKLVAHTHLSYPVGHLSTMYWIGLRPGDTH
LNISSPGWAKHAWSSLFAPWNAEATVFVHNYTRFDPARLMAEMDRAGVTGFCAPPTVWRM
LIQADLTRLATPPREVVAAGEPLNPEVIEHVRRAWGVTIRDGFGQTETTVQVANTPGQPL
KPGSMGRPVPGFAVTLLDPVTGAPADEGEICLDLAARPVGLMAGYEGDADRTAEVTRDGH
YHTGDIGAVDEEGYVTYIGRSDDVFKSSDYKISPFELESALLEHPAVAEAAVVPAPDPLR
LSVPKAYVVLADGWEPDAATAKAIFEHSRAVLAPYKRVRVLEFTELPKTVSGKIRRIALR
ERTASGQAAGALFREDELS
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacagcgcggcgaccgaggagttccgggccgcccgggacttcctgctccggcac
cggacggactaccgggcggcctacgacggcttccgctggccccggcccgagcacttcaac
tgggcgctggactggttcgaccggatcgccgagggcaacgaccgcacggcgctgtggatc
gccgaggaggacggcaccgagacccgccactccttcgccgaactgtccgagcgctccgac
cgggtggccggctggctgcgcgcccggggcgtgcgggccggcgaccggatcgtggtgatg
ctcggcaaccagagcgagttgtggctcaccgcgctcgccgcgatgaagctgcgcgcggtg
gtgatcccggccaccccgctgctgggcgccgccgacctcgccgaccgggtcgcccgcggc
cgggcccgccacgtcatcgtgcgcgccgcggacaccgccaagttcgcctcggtgcccggc
gactacacccgtatcgcggtcggcggcgccccgcaggggtggctcgcctacgaggacgcc
cacaccgcgggggaggcgttcaccccggacgggcccacccgcggcgacgacctgctgatg
ctctacttcacctcgggcaccaccgcgctgcccaagctggtggcgcacacccatctgtcg
tacccggtgggccacttgtcgacgatgtactggatcgggctgcgccccggcgacacccac
ctcaacatctcctcgcccggctgggccaagcacgcctggagcagcctgttcgccccgtgg
aacgccgaggcgacggtcttcgtgcacaactacacccggttcgacccggcccggctgatg
gccgagatggaccgggccggggtgaccggcttctgcgcgccgcccacggtgtggcggatg
ttgatccaggccgacctgacccggctggcgacgccgccgcgcgaggtggtcgcggccggc
gaaccgctcaacccggaggtcatcgagcatgtccggcgggcctggggggtcaccatccgg
gacggcttcgggcagaccgagaccaccgtgcaggtggccaacaccccgggccagccgctc
aagcccgggtcgatggggcgcccggtgcccgggttcgccgtcaccctgctcgacccggtc
accggcgccccggccgacgagggcgagatctgcctggacctcgcggcgcgcccggtgggg
ctgatggccgggtacgagggcgacgccgaccgcaccgccgaggtcacccgggacggccac
taccacaccggtgacatcggcgcggtggacgaggagggctacgtgacctacatcggccgg
agcgacgacgtcttcaagtcctccgactacaagatctccccgttcgagctggagagcgcg
ctgctggagcaccccgcggtggccgaggccgccgtggtgccggcgccggacccgctgcgg
ctgtcggtgcccaaggcgtacgtggtgctggccgacgggtgggagccggacgcggccacc
gccaaggcgatcttcgagcactcccgggccgtgctcgccccctacaagcgggtgcgggtg
ctggagttcaccgagctgcccaagaccgtctcgggcaagatccgccggatcgcgctgcgt
gagcgcaccgcgtcgggccaggccgcgggggcgctcttccgggaggacgagttgagctga

DBGET integrated database retrieval system