KEGG   Streptomyces cattleya NRRL 8057: SCAT_4779Help
Entry
SCAT_4779         CDS       T01646                                 

Definition
Uricase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Purine degradation, xanthine => urea
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SCAT_4779
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    SCAT_4779
Enzymes [BR:sct01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     SCAT_4779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5152952..5153875
Genome map
AA seq 307 aa AA seqDB search
MTTVLGQNQYGKAENRVVRITRDGDTHHIKDLNVSVALSGDMDDVHYSGSNANVLPTDTT
KNTVFAFAKEYGIESAEQFGIHLARHFVTSQEPIKRARIRVEEYSWERIDTSEDNSRFIG
SDEVRHSFVRKGQETRTAQITFDGQRWEVLTGLKDLTVLNSTSSEFWGYVKDKYTTLKED
YDRILATDVTAWWRHNWTSDEERMPNWERSYAQARKHILQAFAETYSLSLQQTLYQMGSR
VINSRPEIDEIRFSLPNKHHFLVDLEPFDLKNDREVYFAADRPYGLIEATVLRDGAQARI
PFDMTNL
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgttctcgggcagaatcagtacggcaaggcggagaaccgcgtcgtcaggatc
acgcgggacggcgacacccaccacatcaaggacctcaacgtctcggtcgccctctccggc
gacatggacgacgtccactactcgggcagcaacgccaacgtactgcccaccgacaccacc
aagaacaccgtcttcgccttcgcgaaggagtacgggatcgagtcggccgagcagttcggc
atccacctcgcccgccacttcgtcaccagccaggaacccatcaagcgggcccgcatccgc
gtcgaggagtactcctgggagcgcatcgacacctccgaggacaactcccgcttcatcggc
tccgacgaggtccggcactccttcgtccgcaagggccaggagacgcgcaccgcccagatc
accttcgacgggcagcggtgggaggtgctcaccggcctgaaggacctgaccgtgctcaac
tccaccagctcggagttctgggggtacgtcaaggacaagtacaccaccttgaaggaggac
tacgaccgcatcctcgccaccgacgtcaccgcctggtggcggcacaactggaccagcgac
gaggagcggatgccgaactgggaacgctcctacgcccaggcccgcaagcacatcctccag
gcgttcgccgagacctacagcctctcgctccagcagacgctgtaccagatgggctcccgg
gtcatcaacagccgcccggagatcgacgagatccgcttctcgctgcccaacaagcaccac
ttcctggtcgacctcgaaccgttcgacctcaagaacgaccgcgaggtctacttcgccgcc
gaccgtccctacggcctgatcgaggccaccgtgctgcgggacggcgcgcaggcccggatc
ccgttcgacatgaccaacctctga

DBGET integrated database retrieval system