KEGG   Streptomyces cattleya NRRL 8057: SCAT_4782Help
Entry
SCAT_4782         CDS       T01646                                 

Gene name
aceB
Definition
Malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:sct01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sct00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:sct00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5157238..5158857)
Genome map
AA seq 539 aa AA seqDB search
MSEAASSPPAVVADGAPPVPRSREVLTDEALAFLAGLHRRFAPRRAELLARRKERRAEIA
RTGTLDFRPETADVRSGDWRVAPAPAALEDRRVEITGPTDRKMTVNALNSGARVWLADFE
DASAPTWHNVVSGQINLIDAYERRIDFTTPEGKSYALKDDAELATVVMRPRGWHLDERHL
TVDGEPVPGALVDFGLYFFHNARRLLAKDKGPYFYLPKTESYLEARLWNDVFVFAQDQLG
IPQGTIRATVLIETITAAFEMEEILYELRDHAAGLNAGRWDYLFSIVKNFRDAGEKFVLP
DRNAVTMTAPFMRAYTELLVRTCHKRGAHAIGGMAAFIPSRRDPEVNAKALEKVRADKER
EAGDGFDGSWVAHPDLVPVARAAFDAVLGERPHQKDRLREEVDVTADQLLAVDSLEAKPT
FEGLRNAVQVGIRYIEAWLRGLGAVAIFNLMEDAATAEISRSQIWQWIDAGVVLDNGEKV
TAELVREVAAAELAAIRAESGEQAFAAGSWQRAHDLLLQVSLDETYVDFLTLPAYELLD
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaagccgcttcctccccgccggccgtcgtcgccgacggtgcgccgcccgtcccc
cggtcgcgggaggtgctgaccgacgaggcgctggcgttcctcgccgggctgcaccgccgg
ttcgcgccgcgccgcgccgaactgctggcccgccgcaaggagcgccgggccgagatcgcc
cgcaccggcaccctggacttccgccccgagaccgccgacgtccgctccggcgactggcgg
gtggccccggcgccggccgcgctggaggaccggcgggtggagatcaccggccccaccgac
cgcaagatgaccgtcaacgccctcaactccggcgcccgggtctggctcgccgacttcgag
gacgcctccgcgcccacctggcacaacgtggtctccggccagatcaacctgatcgacgcc
tacgagcgccggatcgacttcaccacccccgagggcaagagctacgccctcaaggacgac
gccgagctggccaccgtggtgatgcggccccgcggctggcacctggacgaacgccatctg
accgtggacggcgagccggtgcccggcgccctggtcgacttcggcctgtacttcttccac
aacgcgcgccggctgctggccaaggacaagggcccctacttctacctgcccaagaccgag
tcgtacctggaagcccggctgtggaacgacgtcttcgtcttcgcccaggaccagctgggc
atcccgcagggcaccatccgggccaccgtgctgatcgagacgatcaccgcggcgttcgag
atggaggagatcctctacgaactgcgcgaccacgccgccggcctcaacgccgggcgctgg
gactacctgttctccatcgtgaagaacttccgggacgccggtgagaagttcgtcctgccg
gaccgcaacgcggtgaccatgaccgccccgttcatgcgcgcctacaccgagctgctggtg
cgcacctgccacaagcgcggcgcccacgccatcggcgggatggccgcgttcatcccgtcc
cggcgcgacccggaggtcaacgccaaggctttggagaaggtcagggccgacaaggagcgc
gaggccggggacgggttcgacggctcgtgggtggcccaccccgacctggtgccggtggcc
cgggccgccttcgacgcggtgctgggcgaacgcccgcaccagaaggaccggttgcgcgag
gaggtggacgtcaccgccgaccagctgctggcggtggactcgctggaggcgaagccgacc
ttcgaggggctgcgcaacgccgtccaggtgggcatccgctacatcgaggcgtggctgcgc
gggctgggcgcggtcgccatcttcaacctgatggaggacgccgccaccgcggagatctcc
cgctcgcagatctggcagtggatcgacgccggggtcgtcctggacaacggcgagaaggtc
accgccgagctggtgcgcgaggtggccgccgccgaactggccgccatccgggccgagtcg
ggcgagcaggcgttcgccgccggctcctggcagcgcgcgcacgacctgctgctccaggtg
tcgctggacgagacctacgtcgacttcctcaccctgcccgcctacgagctgctggactga

DBGET integrated database retrieval system