KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_4782Help
Entry
SCAT_4782         CDS       T01646                                 

Gene name
aceB
Definition
(GenBank) Malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
sct00620  Pyruvate metabolism
sct00630  Glyoxylate and dicarboxylate metabolism
sct01100  Metabolic pathways
sct01110  Biosynthesis of secondary metabolites
sct01120  Microbial metabolism in diverse environments
sct01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCAT_4782 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    SCAT_4782 (aceB)
Enzymes [BR:sct01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SCAT_4782 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI S4
Motif
Other DBs
NCBI-ProteinID: CCB77470
UniProt: F8JXP4
Position
complement(5157238..5158857)
Genome map
AA seq 539 aa AA seqDB search
MSEAASSPPAVVADGAPPVPRSREVLTDEALAFLAGLHRRFAPRRAELLARRKERRAEIA
RTGTLDFRPETADVRSGDWRVAPAPAALEDRRVEITGPTDRKMTVNALNSGARVWLADFE
DASAPTWHNVVSGQINLIDAYERRIDFTTPEGKSYALKDDAELATVVMRPRGWHLDERHL
TVDGEPVPGALVDFGLYFFHNARRLLAKDKGPYFYLPKTESYLEARLWNDVFVFAQDQLG
IPQGTIRATVLIETITAAFEMEEILYELRDHAAGLNAGRWDYLFSIVKNFRDAGEKFVLP
DRNAVTMTAPFMRAYTELLVRTCHKRGAHAIGGMAAFIPSRRDPEVNAKALEKVRADKER
EAGDGFDGSWVAHPDLVPVARAAFDAVLGERPHQKDRLREEVDVTADQLLAVDSLEAKPT
FEGLRNAVQVGIRYIEAWLRGLGAVAIFNLMEDAATAEISRSQIWQWIDAGVVLDNGEKV
TAELVREVAAAELAAIRAESGEQAFAAGSWQRAHDLLLQVSLDETYVDFLTLPAYELLD
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaagccgcttcctccccgccggccgtcgtcgccgacggtgcgccgcccgtcccc
cggtcgcgggaggtgctgaccgacgaggcgctggcgttcctcgccgggctgcaccgccgg
ttcgcgccgcgccgcgccgaactgctggcccgccgcaaggagcgccgggccgagatcgcc
cgcaccggcaccctggacttccgccccgagaccgccgacgtccgctccggcgactggcgg
gtggccccggcgccggccgcgctggaggaccggcgggtggagatcaccggccccaccgac
cgcaagatgaccgtcaacgccctcaactccggcgcccgggtctggctcgccgacttcgag
gacgcctccgcgcccacctggcacaacgtggtctccggccagatcaacctgatcgacgcc
tacgagcgccggatcgacttcaccacccccgagggcaagagctacgccctcaaggacgac
gccgagctggccaccgtggtgatgcggccccgcggctggcacctggacgaacgccatctg
accgtggacggcgagccggtgcccggcgccctggtcgacttcggcctgtacttcttccac
aacgcgcgccggctgctggccaaggacaagggcccctacttctacctgcccaagaccgag
tcgtacctggaagcccggctgtggaacgacgtcttcgtcttcgcccaggaccagctgggc
atcccgcagggcaccatccgggccaccgtgctgatcgagacgatcaccgcggcgttcgag
atggaggagatcctctacgaactgcgcgaccacgccgccggcctcaacgccgggcgctgg
gactacctgttctccatcgtgaagaacttccgggacgccggtgagaagttcgtcctgccg
gaccgcaacgcggtgaccatgaccgccccgttcatgcgcgcctacaccgagctgctggtg
cgcacctgccacaagcgcggcgcccacgccatcggcgggatggccgcgttcatcccgtcc
cggcgcgacccggaggtcaacgccaaggctttggagaaggtcagggccgacaaggagcgc
gaggccggggacgggttcgacggctcgtgggtggcccaccccgacctggtgccggtggcc
cgggccgccttcgacgcggtgctgggcgaacgcccgcaccagaaggaccggttgcgcgag
gaggtggacgtcaccgccgaccagctgctggcggtggactcgctggaggcgaagccgacc
ttcgaggggctgcgcaacgccgtccaggtgggcatccgctacatcgaggcgtggctgcgc
gggctgggcgcggtcgccatcttcaacctgatggaggacgccgccaccgcggagatctcc
cgctcgcagatctggcagtggatcgacgccggggtcgtcctggacaacggcgagaaggtc
accgccgagctggtgcgcgaggtggccgccgccgaactggccgccatccgggccgagtcg
ggcgagcaggcgttcgccgccggctcctggcagcgcgcgcacgacctgctgctccaggtg
tcgctggacgagacctacgtcgacttcctcaccctgcccgcctacgagctgctggactga

DBGET integrated database retrieval system