KEGG   Streptomyces cattleya NRRL 8057: SCAT_4793Help
Entry
SCAT_4793         CDS       T01646                                 

Gene name
btuE
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SCAT_4793 (btuE)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SCAT_4793 (btuE)
Enzymes [BR:sct01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SCAT_4793 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5167926..5168414
Genome map
AA seq 162 aa AA seqDB search
MSSIYDIPLRTLAGDPATLAEHRGKALLVVNVASKCGLTPQYEGLERLHKRYADRGFTVL
GFPCNQFGGQEPGSSEEIATFCSATYGVTFPLYEKADVNGAGRQPLYTELTRTADADGEA
GDIQWNFEKFLIAPDGTVAARFRPRTDPEAPEVVSAIESLLP
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
gtgtccagcatctacgacatcccgctgcgcaccctcgccggcgaccccgccaccctggcc
gaacaccgcggcaaggcgctgctcgtcgtcaacgtcgcctccaagtgcggcctgaccccc
cagtacgaagggctggagcggctccacaagcgctacgccgaccgcggcttcaccgtactg
ggcttcccctgcaaccagttcggcggccaggagccgggcagctccgaggagatcgccacg
ttctgctcggccacctacggcgtcaccttcccgctgtacgagaaggccgacgtcaacggg
gccggccggcagccgctctacaccgagctgacccgcacggccgacgccgacggcgaggcc
ggggacatccagtggaacttcgagaagttcctcatcgccccggacggcacggtggccgcc
cggttccggccgcgcaccgacccggaggcccccgaggtcgtctcggcgatcgagtcgctg
ctgccgtag

DBGET integrated database retrieval system