KEGG   Streptomyces cattleya NRRL 8057: SCAT_4805Help
Entry
SCAT_4805         CDS       T01646                                 

Gene name
glkA
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:sct01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sct00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sct00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sct00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sct00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:sct00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5180324..5181478
Genome map
AA seq 384 aa AA seqDB search
MSVHRERVPRTGAARATVLQTVQAVGRRERRSHLTAPRVPTVGIDIGGTKVMAGVVDADG
TILEKVRTETPDKSKSPKVVEDTIVELVLDLSERHDVHAVGIGAAGWVDADRSRVLFAPH
LSWRDEPLRDRLATRLLVPVMVDNDANTAAWAEWRFGAGRGEDDLVMITLGTGIGGAILE
DGRVKRGRYGVAGEFGHMQVVPGGHRCPCGNRGCWEQYSSGNALVREARELAAAESPVAY
GIIDRVGGQIGEITGPLITELARSGDAMCVELFQDIGQWLGVGLANLAAALDPSCFVIGG
GVSAADDLLIGPARDAFRRHLTGRGYRPEARIAKAQLGPEAGMVGAADLARLVARRFRRT
NRRRVERYQRAGQARPAATGTVDR
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgtccaccgcgagcgtgtcccccgtacgggcgcggcgcgagccaccgttctgcag
accgtccaggcggtcggccggcgggagcgccgctcgcacctgaccgccccccgggtaccc
accgtgggcatcgacatcggcggcaccaaggtgatggccggggtggtcgacgccgacggc
accatcctggagaaggtgcgcaccgagacccccgacaagtccaagagccccaaggtggtc
gaggacaccatcgtggagctggtgctcgacctgtcggaacgccacgacgtgcacgcggtg
ggcatcggcgcggccggctgggtggacgccgaccgctcccgggtgctcttcgccccccac
ctgtcctggcgcgacgaaccgctgcgcgaccggctcgcgacccgcctgctggtcccggtc
atggtggacaacgacgccaacaccgccgcctgggccgaatggcgcttcggggccggccgc
ggcgaggacgacctggtgatgatcaccctgggcaccgggatcggcggcgccatcctggag
gacggccgggtcaagcgcggccggtacggggtggccggtgagttcggtcacatgcaggtg
gtccccggcggccaccgctgcccgtgcggcaaccgcggctgctgggagcagtacagctcg
ggcaacgcgctggtgcgcgaggcccgtgagctggccgccgccgagtccccggtggcctac
gggatcatcgaccgggtgggcggccagatcggcgagatcaccgggccgctcatcaccgag
ctggcccgctccggcgacgccatgtgcgtcgagctgttccaggacatcggccagtggctc
ggggtcgggctggccaacctcgccgccgccctcgacccgtcctgcttcgtcatcggcggt
ggcgtcagcgccgccgacgacctgctgatcggcccggcccgggacgccttccggcgccat
ctgaccggccgcggctaccgcccggaggcccggatcgccaaggcgcagctcggcccggag
gcgggcatggtgggcgccgccgacctggcccggctggtggcccgccggttccgccgcacc
aaccggcgccgggtcgagcgctaccagcgggccggccaggcccgccccgccgccaccggg
acggtggaccggtga

DBGET integrated database retrieval system