KEGG   Streptomyces cattleya NRRL 8057: SCAT_4805Help
Entry
SCAT_4805         CDS       T01646                                 

Gene name
glkA
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCAT_4805 (glkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCAT_4805 (glkA)
   00052 Galactose metabolism
    SCAT_4805 (glkA)
   00500 Starch and sucrose metabolism
    SCAT_4805 (glkA)
   00520 Amino sugar and nucleotide sugar metabolism
    SCAT_4805 (glkA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SCAT_4805 (glkA)
   00524 Butirosin and neomycin biosynthesis
    SCAT_4805 (glkA)
Enzymes [BR:sct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SCAT_4805 (glkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5180324..5181478
Genome map
AA seq 384 aa AA seqDB search
MSVHRERVPRTGAARATVLQTVQAVGRRERRSHLTAPRVPTVGIDIGGTKVMAGVVDADG
TILEKVRTETPDKSKSPKVVEDTIVELVLDLSERHDVHAVGIGAAGWVDADRSRVLFAPH
LSWRDEPLRDRLATRLLVPVMVDNDANTAAWAEWRFGAGRGEDDLVMITLGTGIGGAILE
DGRVKRGRYGVAGEFGHMQVVPGGHRCPCGNRGCWEQYSSGNALVREARELAAAESPVAY
GIIDRVGGQIGEITGPLITELARSGDAMCVELFQDIGQWLGVGLANLAAALDPSCFVIGG
GVSAADDLLIGPARDAFRRHLTGRGYRPEARIAKAQLGPEAGMVGAADLARLVARRFRRT
NRRRVERYQRAGQARPAATGTVDR
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgtccaccgcgagcgtgtcccccgtacgggcgcggcgcgagccaccgttctgcag
accgtccaggcggtcggccggcgggagcgccgctcgcacctgaccgccccccgggtaccc
accgtgggcatcgacatcggcggcaccaaggtgatggccggggtggtcgacgccgacggc
accatcctggagaaggtgcgcaccgagacccccgacaagtccaagagccccaaggtggtc
gaggacaccatcgtggagctggtgctcgacctgtcggaacgccacgacgtgcacgcggtg
ggcatcggcgcggccggctgggtggacgccgaccgctcccgggtgctcttcgccccccac
ctgtcctggcgcgacgaaccgctgcgcgaccggctcgcgacccgcctgctggtcccggtc
atggtggacaacgacgccaacaccgccgcctgggccgaatggcgcttcggggccggccgc
ggcgaggacgacctggtgatgatcaccctgggcaccgggatcggcggcgccatcctggag
gacggccgggtcaagcgcggccggtacggggtggccggtgagttcggtcacatgcaggtg
gtccccggcggccaccgctgcccgtgcggcaaccgcggctgctgggagcagtacagctcg
ggcaacgcgctggtgcgcgaggcccgtgagctggccgccgccgagtccccggtggcctac
gggatcatcgaccgggtgggcggccagatcggcgagatcaccgggccgctcatcaccgag
ctggcccgctccggcgacgccatgtgcgtcgagctgttccaggacatcggccagtggctc
ggggtcgggctggccaacctcgccgccgccctcgacccgtcctgcttcgtcatcggcggt
ggcgtcagcgccgccgacgacctgctgatcggcccggcccgggacgccttccggcgccat
ctgaccggccgcggctaccgcccggaggcccggatcgccaaggcgcagctcggcccggag
gcgggcatggtgggcgccgccgacctggcccggctggtggcccgccggttccgccgcacc
aaccggcgccgggtcgagcgctaccagcgggccggccaggcccgccccgccgccaccggg
acggtggaccggtga

DBGET integrated database retrieval system