KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_4838Help
Entry
SCAT_4838         CDS       T01646                                 

Gene name
CYP102A
Definition
(GenBank) Bifunctional P-450/NADPH-P450 reductase [Includes: Cytochrome P450 102; NADPH--cytochrome P450 reductase]
  KO
K14338  cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
sct00071  Fatty acid degradation
sct00380  Tryptophan metabolism
sct00627  Aminobenzoate degradation
sct01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    SCAT_4838 (CYP102A)
  Amino acid metabolism
   00380 Tryptophan metabolism
    SCAT_4838 (CYP102A)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SCAT_4838 (CYP102A)
Enzymes [BR:sct01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     SCAT_4838 (CYP102A)
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     SCAT_4838 (CYP102A)
Cytochrome P450 [BR:sct00199]
 Cytochrome P450, bacteria type
  CYP102 family
   SCAT_4838 (CYP102A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: p450 FAD_binding_1 Flavodoxin_1 NAD_binding_1
Motif
Other DBs
NCBI-ProteinID: CCB77526
UniProt: F8JYI6
Position
complement(5209544..5212750)
Genome map
AA seq 1068 aa AA seqDB search
MSPTPHSASGTTGAAAATPGAASPAPPVPVADISDTGFGTTPIQQAMALAREHGPVFRRR
FGTFESLLVGSVDAVTELCDDERFVKAVGPVLTNVRQIAGDGLFTAYNDEPNWAKAHDIL
LPAFALSSMHTYHPTMLRVAKRLIAAWDTALADGAPVDVADDMTRMTLDTIGLAGFGYDF
GSFRRGEPHPFVAAMVRGLLHSQALLSRKADDGVDHSAADEAFRADNAYLAQVVDEVIEA
RRASGETGTDDLLGLMLGAPHPSDGTPLDAANIRNQVITFLIAGHETTSGALSFALYYLA
KNPAVLRRAQAEVDALWGDDPDPEPDYTDVGRLTYVRQVLNEALRLWPTAAAFGRQAVTD
TVLDGRVPMRAGDTALVLTPVLHRDPVWGDNVEAFDPERFSPEREAARPVHAFKPFGTGE
RACIGRQFALHEAVMLLGMLIHRYRFLDHADYRLRVRETLTLKPDGFTLKLARRTSADRV
RTVASRAAEGTAGQDAGLPTTARPGTTLTVLHGSNLGACREFAAGLADLGERCGFETTVA
PLDAYRAGDLPRTSPVVVVAASYNGRPTDDAAGFVSWLEQAGPGAADGVRYAVLGVGDRN
WAATYQKVPTLIDERLAECGATRLLERAAADAAGDLAGTVRGFGEALRRALLAEYGDPDS
VGAVAGAEDGYEVTEVTGGPLDALAARHEVVAMTVTETGDLADLTHPLGRSKRFVRLALP
DGATYRTGDHLAVLPANDPALVERAARLLGADPDTVLGVRARRPGRGTLPVDRPVTVREL
LTYHLELSDPATAAQIAVLADRNPCPPEQAELKKLAPGRASVLDLVERYPALTGRLDWPT
VLGTLLPQIRIRHYSVSSSPAVSPGHVDLMVSLLEADGRRGTGSGHLHRVRPGDVVYARV
APCREAFRIAAGDEVPVVMVAAGTGLAPFRGAVADRVALRSAGRELAPALLYFGCDHPEV
DFLHAAELRGAEAAGAVSLRPAFSAAPDGDVRFVQHRIAAEADEVWSLLKGGARVYVCGD
GSRMAPGVREAFTALYASRTGATAEQAAGWLADLVARGRYVEDVYAAG
NT seq 3207 nt NT seq  +upstreamnt  +downstreamnt
atgagtcctacgccgcacagcgcgtccggcaccaccggcgcggcagccgccaccccgggc
gccgcgtccccggcgccccccgtccccgtggccgacatcagcgacaccggcttcggcacc
accccgatccagcaggcgatggcgctcgcccgcgagcacggaccggtcttccggcgccgg
ttcggcaccttcgagtcgctgctggtgggctcggtggacgcggtgaccgagctgtgcgac
gacgagcggttcgtcaaggcggtcggcccggtgctgaccaacgtccgccagatagccggc
gacggcctgttcaccgcctacaacgacgagcccaactgggccaaggcgcacgacatcctg
ctgccggccttcgcgctcagttcgatgcacacctaccaccccacgatgctaagggtcgcc
aagcggctgatcgccgcctgggacaccgcgctggccgacggcgccccggtcgacgtggcc
gacgacatgaccaggatgaccctggacaccatcgggctggccggcttcgggtacgacttc
ggctcgttccggcgcggcgagccgcacccgttcgtcgccgccatggtgcgcgggctgctg
cacagccaggcgctgctgagccgcaaggccgacgacggggtcgaccacagcgcggccgac
gaggcgttccgggccgacaacgcctatctggcccaggtggtcgacgaggtgatcgaggcc
cggcgggcgagcggtgagaccggcaccgacgacctgctcgggctgatgctgggcgccccg
cacccgtccgacggcaccccgctggacgcggccaacatccgcaaccaggtgatcaccttc
ctgatcgccggccacgagaccacctccggggcgctgtcgttcgccctgtactacctggcc
aagaacccggccgtgctgcgacgcgcccaggcggaggtggacgcgctgtggggcgacgac
ccggatccggagccggactacaccgacgtgggccggctgacctacgtgcggcaggtgctc
aacgaggcgctgcggctgtggccgacggcggctgccttcgggcgccaggcggtcaccgac
accgtgctggacggccgggtgccgatgcgcgccggggacaccgcgctggtgctcaccccg
gtgctccaccgcgacccggtgtggggcgacaacgtggaggcgttcgaccccgagcgcttc
agcccggagcgggaggcggcccgtccggtgcacgccttcaagccgttcggcaccggtgaa
cgcgcctgcatcgggcggcagttcgcgctgcacgaggcggtgatgctgctgggcatgctg
atccaccgctaccgcttcctggaccacgccgactaccggttgcgggtgcgcgagacgctc
accctcaagccggacgggttcaccttgaagctggcccggcgcacctcggcggaccgggtg
cgtacggtggcctcgcgggccgccgagggcaccgccgggcaggacgccgggctgcccacc
acggcccggccgggcaccacgctgaccgtgctgcacggctccaacctgggcgcctgccgg
gagttcgccgccgggctggccgacctgggcgagcggtgcggcttcgagaccacggtggcg
ccgctggacgcctaccgcgccggtgacctgccgcgcacctcgccggtggtcgtggtggcc
gcctcctacaacgggcgacccaccgacgacgcggccggtttcgtctcctggctggagcag
gccgggccgggcgccgcggacggggtgcggtacgcggtgctgggcgtcggcgaccgcaac
tgggcggccacctaccagaaggtgcccaccctcatcgacgagcggctcgccgagtgcggc
gcgacccggctgctggagcgggccgccgccgacgccgccggtgacctggccggcacggta
cgcggcttcggcgaggcgctgcggcgcgcgctgctggccgagtacggcgacccggacagt
gtcggcgcggtggccggcgccgaggacggttacgaggtcaccgaggtgaccggcggcccg
ctggacgcgctcgccgcccgccacgaggtggtggcgatgacggtgaccgagaccggcgac
ctggccgacctcacgcacccgctgggccgctccaagcggttcgtccggctggcgctgccg
gacggtgccacctaccgcaccggtgaccacctggccgtactgccggccaacgacccggcg
ctggtcgaacgcgccgcgcggctgctcggcgccgacccggacaccgtgctcggcgtgcgg
gcccggcgccccggacgcgggacgctgccggtggaccgtccggtgacggtacgcgaactg
ctcacgtaccacctggagttgtcggacccggcgaccgcggcgcagatcgcggtgctggcc
gaccgcaacccgtgcccgccggagcaggcggagctgaagaagctggccccggggcgggcg
agcgtgctggacctggtggagcggtacccggcgctgaccgggcggctggactggccgacc
gtgctgggcacgctgctgccgcagatccggatccgccactactccgtctcctcctccccc
gccgtctcccccggccacgtcgacctgatggtctcgctgctggaggcggacgggcggcgc
ggcaccggctcgggccatctgcaccgggtgcgcccgggtgacgtggtgtacgcgcgggtg
gcgccgtgccgggaggcgttccggatcgccgccggtgacgaggtgccggtggtgatggtg
gcggccggtaccgggctggcgccgttccggggcgcggtcgccgaccgggtggcgctgcgg
tcggcgggccgggaactcgccccggcgctgctgtacttcggctgcgaccaccccgaggtg
gacttcctgcacgcggccgagttgcgcggcgccgaggccgccggggcggtgtcgctgcgt
ccggcgttctccgcggcccccgacggtgacgtgcgcttcgtgcagcaccgcatcgccgcc
gaggccgacgaggtgtggtcgctgctgaagggcggcgcccgggtctacgtgtgcggggac
ggctcgcggatggcgcccggggtgcgcgaggcgttcaccgcgctgtacgcgtcccgtacc
ggcgccaccgccgagcaggccgccgggtggctggccgacctggtggcgcgggggcgttac
gtggaggacgtgtacgccgccgggtga

DBGET integrated database retrieval system