KEGG   Streptomyces cattleya NRRL 8057: SCAT_4838Help
Entry
SCAT_4838         CDS       T01646                                 

Gene name
CYP102A
Definition
Bifunctional P-450/NADPH-P450 reductase
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:sct00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:sct00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:sct00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5209544..5212750)
Genome map
AA seq 1068 aa AA seqDB search
MSPTPHSASGTTGAAAATPGAASPAPPVPVADISDTGFGTTPIQQAMALAREHGPVFRRR
FGTFESLLVGSVDAVTELCDDERFVKAVGPVLTNVRQIAGDGLFTAYNDEPNWAKAHDIL
LPAFALSSMHTYHPTMLRVAKRLIAAWDTALADGAPVDVADDMTRMTLDTIGLAGFGYDF
GSFRRGEPHPFVAAMVRGLLHSQALLSRKADDGVDHSAADEAFRADNAYLAQVVDEVIEA
RRASGETGTDDLLGLMLGAPHPSDGTPLDAANIRNQVITFLIAGHETTSGALSFALYYLA
KNPAVLRRAQAEVDALWGDDPDPEPDYTDVGRLTYVRQVLNEALRLWPTAAAFGRQAVTD
TVLDGRVPMRAGDTALVLTPVLHRDPVWGDNVEAFDPERFSPEREAARPVHAFKPFGTGE
RACIGRQFALHEAVMLLGMLIHRYRFLDHADYRLRVRETLTLKPDGFTLKLARRTSADRV
RTVASRAAEGTAGQDAGLPTTARPGTTLTVLHGSNLGACREFAAGLADLGERCGFETTVA
PLDAYRAGDLPRTSPVVVVAASYNGRPTDDAAGFVSWLEQAGPGAADGVRYAVLGVGDRN
WAATYQKVPTLIDERLAECGATRLLERAAADAAGDLAGTVRGFGEALRRALLAEYGDPDS
VGAVAGAEDGYEVTEVTGGPLDALAARHEVVAMTVTETGDLADLTHPLGRSKRFVRLALP
DGATYRTGDHLAVLPANDPALVERAARLLGADPDTVLGVRARRPGRGTLPVDRPVTVREL
LTYHLELSDPATAAQIAVLADRNPCPPEQAELKKLAPGRASVLDLVERYPALTGRLDWPT
VLGTLLPQIRIRHYSVSSSPAVSPGHVDLMVSLLEADGRRGTGSGHLHRVRPGDVVYARV
APCREAFRIAAGDEVPVVMVAAGTGLAPFRGAVADRVALRSAGRELAPALLYFGCDHPEV
DFLHAAELRGAEAAGAVSLRPAFSAAPDGDVRFVQHRIAAEADEVWSLLKGGARVYVCGD
GSRMAPGVREAFTALYASRTGATAEQAAGWLADLVARGRYVEDVYAAG
NT seq 3207 nt NT seq  +upstreamnt  +downstreamnt
atgagtcctacgccgcacagcgcgtccggcaccaccggcgcggcagccgccaccccgggc
gccgcgtccccggcgccccccgtccccgtggccgacatcagcgacaccggcttcggcacc
accccgatccagcaggcgatggcgctcgcccgcgagcacggaccggtcttccggcgccgg
ttcggcaccttcgagtcgctgctggtgggctcggtggacgcggtgaccgagctgtgcgac
gacgagcggttcgtcaaggcggtcggcccggtgctgaccaacgtccgccagatagccggc
gacggcctgttcaccgcctacaacgacgagcccaactgggccaaggcgcacgacatcctg
ctgccggccttcgcgctcagttcgatgcacacctaccaccccacgatgctaagggtcgcc
aagcggctgatcgccgcctgggacaccgcgctggccgacggcgccccggtcgacgtggcc
gacgacatgaccaggatgaccctggacaccatcgggctggccggcttcgggtacgacttc
ggctcgttccggcgcggcgagccgcacccgttcgtcgccgccatggtgcgcgggctgctg
cacagccaggcgctgctgagccgcaaggccgacgacggggtcgaccacagcgcggccgac
gaggcgttccgggccgacaacgcctatctggcccaggtggtcgacgaggtgatcgaggcc
cggcgggcgagcggtgagaccggcaccgacgacctgctcgggctgatgctgggcgccccg
cacccgtccgacggcaccccgctggacgcggccaacatccgcaaccaggtgatcaccttc
ctgatcgccggccacgagaccacctccggggcgctgtcgttcgccctgtactacctggcc
aagaacccggccgtgctgcgacgcgcccaggcggaggtggacgcgctgtggggcgacgac
ccggatccggagccggactacaccgacgtgggccggctgacctacgtgcggcaggtgctc
aacgaggcgctgcggctgtggccgacggcggctgccttcgggcgccaggcggtcaccgac
accgtgctggacggccgggtgccgatgcgcgccggggacaccgcgctggtgctcaccccg
gtgctccaccgcgacccggtgtggggcgacaacgtggaggcgttcgaccccgagcgcttc
agcccggagcgggaggcggcccgtccggtgcacgccttcaagccgttcggcaccggtgaa
cgcgcctgcatcgggcggcagttcgcgctgcacgaggcggtgatgctgctgggcatgctg
atccaccgctaccgcttcctggaccacgccgactaccggttgcgggtgcgcgagacgctc
accctcaagccggacgggttcaccttgaagctggcccggcgcacctcggcggaccgggtg
cgtacggtggcctcgcgggccgccgagggcaccgccgggcaggacgccgggctgcccacc
acggcccggccgggcaccacgctgaccgtgctgcacggctccaacctgggcgcctgccgg
gagttcgccgccgggctggccgacctgggcgagcggtgcggcttcgagaccacggtggcg
ccgctggacgcctaccgcgccggtgacctgccgcgcacctcgccggtggtcgtggtggcc
gcctcctacaacgggcgacccaccgacgacgcggccggtttcgtctcctggctggagcag
gccgggccgggcgccgcggacggggtgcggtacgcggtgctgggcgtcggcgaccgcaac
tgggcggccacctaccagaaggtgcccaccctcatcgacgagcggctcgccgagtgcggc
gcgacccggctgctggagcgggccgccgccgacgccgccggtgacctggccggcacggta
cgcggcttcggcgaggcgctgcggcgcgcgctgctggccgagtacggcgacccggacagt
gtcggcgcggtggccggcgccgaggacggttacgaggtcaccgaggtgaccggcggcccg
ctggacgcgctcgccgcccgccacgaggtggtggcgatgacggtgaccgagaccggcgac
ctggccgacctcacgcacccgctgggccgctccaagcggttcgtccggctggcgctgccg
gacggtgccacctaccgcaccggtgaccacctggccgtactgccggccaacgacccggcg
ctggtcgaacgcgccgcgcggctgctcggcgccgacccggacaccgtgctcggcgtgcgg
gcccggcgccccggacgcgggacgctgccggtggaccgtccggtgacggtacgcgaactg
ctcacgtaccacctggagttgtcggacccggcgaccgcggcgcagatcgcggtgctggcc
gaccgcaacccgtgcccgccggagcaggcggagctgaagaagctggccccggggcgggcg
agcgtgctggacctggtggagcggtacccggcgctgaccgggcggctggactggccgacc
gtgctgggcacgctgctgccgcagatccggatccgccactactccgtctcctcctccccc
gccgtctcccccggccacgtcgacctgatggtctcgctgctggaggcggacgggcggcgc
ggcaccggctcgggccatctgcaccgggtgcgcccgggtgacgtggtgtacgcgcgggtg
gcgccgtgccgggaggcgttccggatcgccgccggtgacgaggtgccggtggtgatggtg
gcggccggtaccgggctggcgccgttccggggcgcggtcgccgaccgggtggcgctgcgg
tcggcgggccgggaactcgccccggcgctgctgtacttcggctgcgaccaccccgaggtg
gacttcctgcacgcggccgagttgcgcggcgccgaggccgccggggcggtgtcgctgcgt
ccggcgttctccgcggcccccgacggtgacgtgcgcttcgtgcagcaccgcatcgccgcc
gaggccgacgaggtgtggtcgctgctgaagggcggcgcccgggtctacgtgtgcggggac
ggctcgcggatggcgcccggggtgcgcgaggcgttcaccgcgctgtacgcgtcccgtacc
ggcgccaccgccgagcaggccgccgggtggctggccgacctggtggcgcgggggcgttac
gtggaggacgtgtacgccgccgggtga

DBGET integrated database retrieval system