KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_4918Help
Entry
SCAT_4918         CDS       T01646                                 

Definition
(GenBank) Enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
sct00071  Fatty acid degradation
sct00280  Valine, leucine and isoleucine degradation
sct00281  Geraniol degradation
sct00310  Lysine degradation
sct00360  Phenylalanine metabolism
sct00362  Benzoate degradation
sct00380  Tryptophan metabolism
sct00410  beta-Alanine metabolism
sct00627  Aminobenzoate degradation
sct00640  Propanoate metabolism
sct00650  Butanoate metabolism
sct00903  Limonene and pinene degradation
sct00930  Caprolactam degradation
sct01100  Metabolic pathways
sct01110  Biosynthesis of secondary metabolites
sct01120  Microbial metabolism in diverse environments
sct01130  Biosynthesis of antibiotics
sct01212  Fatty acid metabolism
Module
sct_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SCAT_4918
   00650 Butanoate metabolism
    SCAT_4918
  Lipid metabolism
   00071 Fatty acid degradation
    SCAT_4918
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCAT_4918
   00310 Lysine degradation
    SCAT_4918
   00360 Phenylalanine metabolism
    SCAT_4918
   00380 Tryptophan metabolism
    SCAT_4918
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCAT_4918
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SCAT_4918
   00281 Geraniol degradation
    SCAT_4918
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SCAT_4918
   00627 Aminobenzoate degradation
    SCAT_4918
   00930 Caprolactam degradation
    SCAT_4918
Enzymes [BR:sct01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SCAT_4918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: CCB77606
UniProt: F8JZI4
Position
complement(5309630..5310403)
Genome map
AA seq 257 aa AA seqDB search
MPEAPLVRRDRERGITTLTLDSPHNRNALSARLVGELHEGLAAAAEDRDTRAVLLTHTGN
TFCAGADLSEPAPTGPRELTALLRAVVELPKPVVAVATGHVRAGGLGLLAACDITLAGPA
ATFAFTESRLGLAPAVISLTVLERTEPRAVARYYLTGEVFPVAEAVRIGLVTAGEEALPE
VLAGLRAASPQGLAESKRLTTARVLRAFDRDAAELADRSARLFASAEAAEGMRAFLERRA
PAWSLDGGGGPAAGGRR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaggctcccctcgtccgccgcgaccgtgaacgcggcatcaccacgctgaccctg
gactccccgcacaaccgcaacgccctgtcggcccggctggtcggcgagttgcacgagggc
ctggccgcggcggcggaggaccgggacacccgggcggtgctgctcacccacaccggcaac
accttctgcgccggcgccgatctgagcgagccggcgcccaccggcccgcgtgagctgacc
gcgctgctgcgggcggtggtcgaactgcccaagccggtggtcgcggtggccaccggccac
gtccgggcgggcggactcgggctgctggccgcctgcgacatcacgctggccggaccggcg
gccaccttcgcgttcaccgagtcccggctggggctggcgccggcggtgatctcgctgacc
gtgctggagcgcaccgagccgcgcgcggtggcccgttactacctgaccggggaggtcttc
ccggtggccgaggcggtgcggatcgggctggtcacggcgggtgaggaggcgttgccggag
gtgctcgccgggctgcgggcggcctccccgcaggggctggccgagtccaagcggctgacc
acggcacgggtgctgcgcgccttcgaccgggacgcggcggagctggccgatcggtcggcg
cggctgttcgcctcggcggaggcggcggaggggatgcgggcgttcctggagcggcgcgcc
ccggcctggtccctcgacggcggcggtggaccggccgcggggggccggcggtga

DBGET integrated database retrieval system