KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_5103Help
Entry
SCAT_5103         CDS       T01646                                 

Definition
(GenBank) putative fatty acid oxidation complex alpha-subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
sct00071  Fatty acid degradation
sct00280  Valine, leucine and isoleucine degradation
sct00281  Geraniol degradation
sct00310  Lysine degradation
sct00362  Benzoate degradation
sct00380  Tryptophan metabolism
sct00410  beta-Alanine metabolism
sct00640  Propanoate metabolism
sct00650  Butanoate metabolism
sct00903  Limonene and pinene degradation
sct00930  Caprolactam degradation
sct01040  Biosynthesis of unsaturated fatty acids
sct01100  Metabolic pathways
sct01110  Biosynthesis of secondary metabolites
sct01120  Microbial metabolism in diverse environments
sct01130  Biosynthesis of antibiotics
sct01200  Carbon metabolism
sct01212  Fatty acid metabolism
Module
sct_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SCAT_5103
   00650 Butanoate metabolism
    SCAT_5103
  Lipid metabolism
   00071 Fatty acid degradation
    SCAT_5103
   01040 Biosynthesis of unsaturated fatty acids
    SCAT_5103
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCAT_5103
   00310 Lysine degradation
    SCAT_5103
   00380 Tryptophan metabolism
    SCAT_5103
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCAT_5103
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SCAT_5103
   00281 Geraniol degradation
    SCAT_5103
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SCAT_5103
   00930 Caprolactam degradation
    SCAT_5103
Enzymes [BR:sct01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SCAT_5103
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SCAT_5103
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SCAT_5103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 DAO F420_oxidored NAD_binding_8 AlaDh_PNT_C UDPG_MGDP_dh_N NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: CCB77791
UniProt: F8K1H5
Position
5509208..5511382
Genome map
AA seq 724 aa AA seqDB search
MPESTTIRWEQDADGVVTLVLDDPGQSANTMNAAFADSLDAVVGRLESERDTIRGVVVTS
AKKTFFAGGDLRDLIRATPENAAEVFEGGMRVKRLLRRLETLGRPVVAAINGAALGGGYE
IALACHHRVALDAPGSRIGLPEVTLGLLPGSGGVVRTVRLMGIADALLKVLLQGTRYTPR
RAVEAGLVHELAATPEELTAKARAFIDAHPDARQPWDTDGYKIPGGTPAHPAFAANLPAF
PANLSKQLGGAPYPAPRDILAAAVEGSQVDFDTAQVIEARYFTELACGPISKNMIQAFFF
DMQAVNSGASRPAGVEPSTVTRVAVLGAGMMGAGIAYACAKSGLDVVLKDVTAEAAERGK
AYSATLLDKALAKGRTTERERDELLARITPTADTADLAGCDAVIEAVFEDTALKHKVFQE
IEGVVAPDALLCTNTSTLPITLLAEGVQRQEDFIGLHFFSPVDKMPLVEIVKGERTGQTA
LARAFDLVRRIRKTPIVVNDSRGFFTSRVIGQFINEGVAMVGEGVEPASIEQAAAQAGYP
AKVLTLMDELTLTLPRKIRNETRQAVEAAGGTWTAHPAEAVIDRMVDEFGRTGRGGGAGF
YDYADGRRTRLWPGLREHFTRPDADVPFTDIKERMLFAEALDSVRCLEEGVLTSVADANI
GSILGIGFPAWTGGVLQYVNGYEGGLPGFVARARELQAAYGDRFAPPPLLLAKAERGEVF
TDAR
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagagcaccacgatccgctgggaacaggacgccgacggtgtcgtcaccctcgtc
ctcgacgaccccggccagtccgccaacaccatgaacgcggccttcgccgactccctcgac
gccgtcgtcggccgcctggagagcgaacgcgacaccatccggggcgtcgtcgtcacctcc
gccaagaagaccttcttcgccggcggcgacctgcgcgacctgatccgcgccacccccgag
aacgccgccgaggtcttcgagggcggcatgcgcgtcaagcggctgctgcgccgcctggag
acgctcggccggccggtcgtcgccgccatcaacggcgcggccctcggcggcggttacgag
atcgccctcgcctgccaccaccgcgtcgccctcgacgcccccggcagccgcatcggcctg
cccgaggtcaccctcggcctgctgcccggcagcggcggcgtggtccgcacggtacggctg
atggggatcgccgacgcgctgctcaaggtgctcctccagggcacccggtacaccccgcgc
cgcgcggtggaggccggcctggtccacgaactcgccgccacgcccgaggagttgacggcc
aaggcccgcgccttcatcgacgcccaccccgacgcccgccagccctgggacaccgacggc
tacaagatccccggcggcaccccggcccaccccgcgttcgccgccaacctccccgccttc
ccggccaacctcagcaagcaactgggcggcgccccctaccccgcgccccgcgacatcctg
gccgccgccgtcgagggctcccaggtcgacttcgacaccgcccaggtcatcgaggcccgc
tacttcaccgaactggcctgcggaccgatctcgaagaacatgatccaggcgttcttcttc
gacatgcaggcggtcaactccggcgcctcccgcccggccggcgtcgagccgtccaccgtc
accagggtcgccgtcctcggcgccggcatgatgggcgccggcatcgcctacgcctgcgcc
aagtccggcctggacgtggtcctcaaggacgtcaccgccgaggccgccgaacgcggcaag
gcgtactcggccaccctgctcgacaaggcgctcgccaaggggcgcaccaccgagagggaa
cgcgacgaactgctggcccggatcacccccaccgccgacaccgccgacctggccggctgc
gacgcggtgatcgaggcggtcttcgaggacaccgccctcaagcacaaggtcttccaggag
atcgagggcgtcgtcgcccccgacgcgctgctgtgcaccaacacctccaccctgccgatc
accctgctcgccgagggcgtccaacgccaggaggacttcatcggcctgcacttcttctca
cccgtggacaagatgccgctggtggagatcgtcaagggcgagcgcaccggacagaccgcg
ctggcccgcgccttcgacctggtccgccggatccgcaagaccccgatcgtggtcaacgac
tcccggggcttcttcacctcccgcgtcatcggccagttcatcaacgagggcgtcgccatg
gtcggcgagggcgtcgaacccgcctcgatcgagcaggccgccgcccaggccggctacccg
gccaaggtgctgacgctgatggacgagctgaccctgaccctgccgcgcaagatccgcaac
gagacccggcaggccgtcgaggcggccggcggcacctggaccgcccaccccgccgaggcc
gtcatcgaccgcatggtcgacgagttcggccgcaccggacgcggcggcggcgccggcttc
tacgactacgccgacggccggcgcaccaggctctggccggggctgcgcgaacacttcacc
cgccccgacgccgacgtccccttcaccgacatcaaggagcggatgctcttcgccgaggcg
ctggactcggtgcgctgcctggaggagggcgtgctgacctcggtcgccgacgccaacatc
ggctccatcctcggcatcggcttccccgcctggaccggcggggtgctccagtacgtcaac
ggctacgagggcggcctgcccggcttcgtagcccgggccagggaactccaggcggcctac
ggcgaccgcttcgccccgccgccgctgctgctggccaaggcggaacgcggcgaggtcttc
accgacgcccgctga

DBGET integrated database retrieval system