KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_5151Help
Entry
SCAT_5151         CDS       T01646                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SCAT_5151
Enzymes [BR:sct01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SCAT_5151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5557775..5559382)
Genome map
AA seq 535 aa AA seqDB search
MSTPLRVPALGTHPAAGRNPSRDETRDLLSRATYDLLVIGGGILGTSVAWHASQAGLRVA
MVDAGDFAGATSSASSKLVHGGLRYLQTGAVKLVAENHHERRVLAKDVAPHLVNPLTFYL
PVYKGGPHGAAKLGAGVFAYSMLSAFGDGVGRVISPARAAADNPALRTENLKAVAVYGDH
QMNDSRVAVMTVRAAVESGAVVLNHAEVTGLRFTDGRVTGAELRDRLDGTEFGVDARLVL
NATGPWVDHLRRMEDAGAAPSIRLSKGAHLVLKRKAPWKAAMATPIDKYRITFALPWEDQ
LLLGTTDEEYTGDPADVRVTEADIQQILDEAAFSVRDEHLDRELMTYAFAGLRVLPGGPG
GVESAKRETVVTEGRGGMLSVAGGKWTTYRHIGRTVMDKLAKLPGHPLRGDMQPVGDLVR
RVPLPGVANPNAVAHRLLVDREPGTRLEPETARHLATHYGALSFDIARLVNEDPALAERI
HPDGPEIWAQVVYARDHEWAQTPEDVLRRRTTLTVRGLDTEQVRERVAALLAERG
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccccgctgcgcgtccccgccctggggacgcacccggccgccggccgcaacccc
agccgtgacgagacccgtgacctgctgagccgcgccacgtacgacctgttggtgatcggc
ggcggcatcctcggcacctcggtggcgtggcacgcgtcccaggccggactgcgggtcgcg
atggtggacgccggcgacttcgccggcgccacctcctccgcctcctccaagctcgtccac
ggcggtctgcgctacctgcagaccggcgcggtcaagctggtggcggagaaccaccacgag
cgccgggtcctggccaaggacgtcgccccgcacctggtcaacccgctcaccttctacctg
ccggtgtacaagggcggcccgcacggcgcggccaagctgggcgccggtgtcttcgcctac
tcgatgctctccgccttcggcgacggcgtgggccgggtcatctccccggcccgggccgcc
gccgacaacccggcgctgcgcaccgagaacctcaaggcggtcgcggtctacggcgaccac
cagatgaacgactcccgggtggccgtgatgacggtccgggccgccgtggagtccggtgcc
gtggtgctcaaccacgccgaggtgaccgggctgcggttcaccgacggccgggtcaccggc
gccgagctgagggaccggctggacggcaccgagttcggcgtcgacgcccggctggtgctc
aacgccaccggcccctgggtggaccacctgcgcaggatggaggacgccggggccgccccc
agcatccggctgtccaagggcgcccacctggtgctcaagcgcaaggcgccgtggaaggcc
gccatggccaccccgatcgacaagtaccggatcaccttcgcgctgccgtgggaggaccag
ctgctgctgggcaccaccgacgaggagtacaccggtgacccggccgacgtgcgggtgacc
gaggccgacatccagcagatcctggacgaggcggccttctcggtgcgcgacgagcacctc
gaccgcgagctgatgacctacgccttcgcggggctgcgggtgctgcccggcggcccgggc
ggcgtggagtccgccaagcgcgagaccgtggtcaccgaggggcgcggcgggatgctgtcg
gtggccggcggcaagtggaccacctaccggcacatcggccgcaccgtgatggacaagctc
gccaagctgcccggccacccgctccgcggtgacatgcagcccgtcggcgacctggtgcgc
cgggtgccgctgccgggcgtggccaaccccaacgcggtcgcccaccggctgctggtggac
cgcgagccgggcacccggctggagccggagaccgcgcgtcatctggccacccattacggc
gcgttgtccttcgacatcgcccggctggtcaacgaggacccggcgctggccgagcggatc
cacccggacggcccggagatctgggcccaggtcgtctacgcccgcgaccacgagtgggcg
cagacccccgaggacgtgctgcgccggcgcaccacgctgaccgtgcgcggcctcgacacc
gagcaggtgcgcgagcgggtcgccgcgctcctggccgagcggggctga

DBGET integrated database retrieval system