KEGG   Streptomyces cattleya NRRL 8057: SCAT_5337Help
Entry
SCAT_5337         CDS       T01646                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SCAT_5337 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCAT_5337 (pyrB)
Enzymes [BR:sct01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     SCAT_5337 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5750281..5751303
Genome map
AA seq 340 aa AA seqDB search
MKRHLISAADLTRDDALLVLDTAEEMARLADRPIKKLPTLRGRTVVNLFFEDSTRTRISF
EAAAKRLSADVINFSAKGSSVSKGESLKDTALTLEAMGADAVVVRHHASGAPHRLATSDW
IGGSVVNAGDGTHEHPTQALLDAFTMRRHLAGAPDGGPTHHRGPGDGTGRDLAGRRITIV
GDVLHSRVARSNVLLLGTLGAEVTLVAPPTLLPIGVERWPCEVSYDLDSVLAKSDAVMML
RVQNERMNAAFFPTEREYARRYGLDGIRMAALPEHAIVMHPGPMNRGMEITAEVADSGRC
TAVEQVANGVSVRMAVLYLLLGGNEPASPANTNHRTEENN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtcacctgatctcggccgcggacctcacccgcgacgacgcgctgctggtcctc
gacaccgccgaggagatggcccgtctcgccgaccggccgatcaagaagctgcccaccctg
cgtggccgtaccgtggtcaacctcttcttcgaggactccacccgcacccggatctccttc
gaggccgccgccaagcgcctgtcggccgacgtgatcaacttctccgccaagggctcctcg
gtctccaagggcgaatcgctcaaggacaccgcgctcaccctggaggcgatgggcgccgac
gcggtcgtggtccgccaccacgcctccggcgccccgcaccggctggccacctccgactgg
atcggcggctcggtggtcaacgccggcgacggcacccacgaacaccccacccaggcgctg
ctggacgccttcaccatgcgccgccacctggccggcgccccggacggcggccccacccac
caccgcggccccggcgacggcaccggacgcgacctggccggccgccggatcaccatcgtc
ggcgacgtcctgcacagccgggtggcccgctccaacgtgctgctgctgggcaccctcggc
gccgaggtcaccctggtcgcgccgcccaccctgctgcccatcggcgtggagcgctggccc
tgcgaggtctcctacgacctggactcggtgctcgccaagtcggacgccgtgatgatgctg
cgggtgcagaacgagcggatgaacgccgccttcttccccaccgagcgggagtacgcccgc
cgctacggcctggacggcatccggatggccgccctgcccgagcacgccatcgtgatgcac
cccggcccgatgaaccgcggcatggagatcaccgccgaggtcgccgactccggccggtgc
accgccgtcgaacaggtcgccaacggcgtcagcgtccgcatggccgtgctctacctgctg
ctcggcggcaacgaacccgcctcccccgcgaacacgaaccaccgcaccgaggagaacaac
tga

DBGET integrated database retrieval system