KEGG   Streptomyces cattleya NRRL 8057: SCAT_5345Help
Entry
SCAT_5345         CDS       T01646                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:sct00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5760479..5761021
Genome map
AA seq 180 aa AA seqDB search
MLSGPSGVGKSTVVAHLRRVHPEVWLSVSVTTRKPRPGEVDGVQYHFVDGDEFDKLVANG
ELLEWAEFAGNRYGTPRQAVLERLEAGVPVLLEIDLQGARLVRRSMPQARLVFLAPPSWD
ELVRRLTGRGTESPEVIERRLEAARVELAAESEFDVTLVNTSVEDVTRELLALMTHNSGG
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
gtgctctccggcccctccggggtcggcaagagcacggtcgtcgcgcatctgcgtcgtgta
caccccgaagtctggctgtccgtctccgtcaccacccgcaagccccgcccgggtgaggtc
gacggggtgcagtaccacttcgtcgacggtgacgagttcgacaagctggtcgccaacggc
gagttgctggagtgggccgagttcgccggcaaccgctacggcaccccgcgccaggccgtc
ctggagcggctggaggcgggcgttccggtgctgctggagatcgacctgcaaggcgcccgg
ctggtgcgccgctccatgccgcaggcccggctggtcttcctggccccgccgagctgggac
gagctggtgcgccggctcaccggccgcggcaccgagtcgcccgaggtgatcgagcggcgg
ctggaggcggcccgggtcgagctggcggccgagtcggagttcgacgtcaccctggtcaac
acctccgtcgaggacgtcacgcgcgaactgctagccttgatgacgcataactctgggggc
tga

DBGET integrated database retrieval system