KEGG   Streptomyces cattleya NRRL 8057: SCAT_5450Help
Entry
SCAT_5450         CDS       T01646                                 

Gene name
echA
Definition
enoyl-CoA hydratase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SCAT_5450 (echA)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SCAT_5450 (echA)
   00650 Butanoate metabolism
    SCAT_5450 (echA)
  Lipid metabolism
   00071 Fatty acid degradation
    SCAT_5450 (echA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCAT_5450 (echA)
   00310 Lysine degradation
    SCAT_5450 (echA)
   00360 Phenylalanine metabolism
    SCAT_5450 (echA)
   00380 Tryptophan metabolism
    SCAT_5450 (echA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCAT_5450 (echA)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SCAT_5450 (echA)
   00281 Geraniol degradation
    SCAT_5450 (echA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SCAT_5450 (echA)
   00627 Aminobenzoate degradation
    SCAT_5450 (echA)
   00930 Caprolactam degradation
    SCAT_5450 (echA)
Enzymes [BR:sct01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SCAT_5450 (echA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5857942..5858694
Genome map
AA seq 250 aa AA seqDB search
MERRGPVTTVVLDRPERRNAVDGATAAQLADAFRAFDADDEARAAVLWGAGGTFCSGADL
TAVGTAHGNRVAPDGDGPMGPTRLRTAKPVIAAIAGYAVAGGLELALWCDLRVAEEDAVL
GVFCRRWGVPLIDGGTVRLPRLIGLGRAMDLVLTGRPVDAAEALSIGLVNRVVPPGTSRA
AAEQLAAGLARFPQDCLRADRDSLLGQQGLPEEEAMAAELRGGQRVLGQAVEGARRFAEG
AGRHGDFEAI
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
gtggaacggcgaggtccggtcaccacggtcgtgctggaccggccggaacgccgcaacgcc
gtggacggggccaccgcggcccaactcgccgacgccttccgcgcgttcgacgccgacgac
gaggcgagggcggccgtgctgtggggcgcgggcggcacgttctgctccggcgccgacctg
acggcggtgggcaccgcgcacggcaaccgggtcgccccggacggcgacgggccgatgggc
ccgacccggctgcggacggccaagccggtgatcgccgccatcgccgggtacgcggtggcc
ggcggtctggagctggcgctctggtgtgatctgcgggtggccgaggaggacgccgtcctc
ggggtgttctgccgccggtggggggtgccgctgatcgacggcggtacggtgcggctgccc
cggctgatcggactgggccgggcgatggacctggtgctgaccggacgcccggtggacgcg
gccgaggcgctctccatcgggctggtcaaccgcgttgtgccacccgggacttcacgtgcc
gccgcggaacagctcgcggccggtctggcccgcttcccccaggactgcctgcgcgccgac
cgcgattccctcctgggccagcagggcctgccggaggaggaggcgatggcggccgaactg
cggggcgggcagcgggtgctggggcaggcggtggaaggcgcccggcggttcgccgagggc
gccggacgacacggtgacttcgaggcgatctga

DBGET integrated database retrieval system