KEGG   Streptomyces cattleya NRRL 8057: SCAT_5529Help
Entry
SCAT_5529         CDS       T01646                                 

Definition
Alcohol dehydrogenase GroES-like
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SCAT_5529
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCAT_5529
  Lipid metabolism
   00071 Fatty acid degradation
    SCAT_5529
  Amino acid metabolism
   00350 Tyrosine metabolism
    SCAT_5529
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SCAT_5529
   00626 Naphthalene degradation
    SCAT_5529
Enzymes [BR:sct01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SCAT_5529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5942240..5943130)
Genome map
AA seq 296 aa AA seqDB search
MCGVCRTDLHLAEGDLPPRRPMCVPGHEIVGRVVEAGHAVRGFAPGDRVGAAWLAGTCGR
CAYCRSGRENLCPRSRYTGWDVDGGYAGHVLVDARYAYRPPAGWADDETAPLLCAGIIGY
RALCRAELPPGGRLGVYGFGASAHLTAQLALARGATVHVLTRGERARRLALDLGAASARD
AYETPPEPLDAAILFAPAGELVPVALAALDRGGTLAIAGIHLSAVPALDYRRHLFQERTV
RSVTANTREDGRAFLAEAARLRPSVRLTRYPMRRADRALADLAAGEVTGVAVLMAQ
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgtgcggggtctgccgcaccgatctccacctggccgagggtgacctgcccccgcgccgc
ccgatgtgcgtgcccggccacgagatcgtcgggcgggtggtcgaggccggccacgcggtg
cgcggcttcgcccccggcgaccgggtcggggccgcctggctggccggcacctgcggccgt
tgcgcctactgccggtcggggcgggagaacctgtgcccgcgttcccggtacaccggctgg
gacgtcgacggcgggtacgccggccacgtgctggtggacgcccgctacgcctaccggccc
ccggccggctgggcggacgacgagacggcgccgctgctgtgcgccggcatcatcggctac
cgcgccctgtgccgcgccgaactgccgcccggcggacgtctgggcgtctacgggttcggc
gcctccgcccatctgaccgcgcagctcgcgctggcccgcggcgccaccgtgcacgtgctc
acccgtggcgagcgggcccgccggctcgcgctcgacctgggcgcggcgtccgcccgggac
gcgtacgagacaccgccggagccgctggacgcggcgatcttgttcgcgcccgccggtgag
ctggtgccggtggcgctggccgcgctcgaccggggcggcaccctcgccatcgcgggcatc
cacctgtccgccgttcccgcgctggactaccggcgccatctgttccaggaacgtacggtg
cgcagcgtcaccgccaacacccgtgaggacggccgggcgttcctcgccgaggccgcccgg
ctgcgcccctccgtgcggctgacccgctatccgatgcgccgggccgaccgggcgctggcc
gacctggcggcgggcgaggtgacgggggtggcggtgctgatggcgcaatga

DBGET integrated database retrieval system