KEGG   Streptomyces cattleya NRRL 8057: SCAT_5671Help
Entry
SCAT_5671         CDS       T01646                                 

Gene name
bdhA
Definition
(RefSeq) D-beta-hydroxybutyrate dehydrogenase
  KO
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    SCAT_5671 (bdhA)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    SCAT_5671 (bdhA)
Enzymes [BR:sct01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     SCAT_5671 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6091443..6092222
Genome map
AA seq 259 aa AA seqDB search
MESSTRNREGTPAPLAGRTALVTGAASGIGRACAVALAEAGAHVHVVDIAADGAEEVAAR
VGGRAHVADLADPDAVDALPADVDIVVNNAGLQHVAPVHEFPPERFALIQRVMVEAPFRI
LRRTLPGMYRRGWGRVVNISSVHGLRASPYKSAYVAAKHALEGLSKVVALEAAPHGVTSN
CVNPGYVRTPLVERQIAAQAEAHGIGEDEVVREVMLERTAIKRLIEPEEVAAVVLWLCGP
HSGYLTGASVPVDGGWTAH
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcagcacacgaaaccgggagggcacccccgcgcccctcgccggccgcaccgcc
ctggtgaccggtgcggccagcggcatcggcagggcctgcgccgtggcgctcgccgaggcc
ggcgcccacgtccacgtggtcgacatcgccgccgacggcgccgaggaggtcgccgcacgc
gtcggcggccgggcccacgtcgccgacctcgccgatccggacgcggtggacgccctgccc
gccgatgtcgacatcgtggtgaacaacgccgggttgcagcacgtggccccggtgcacgag
ttcccgccggagcggttcgccctcatccagcgggtgatggtggaggccccgttccgcatc
ctgcgccgcaccctgcccgggatgtaccggcgcggctgggggcgggtggtcaacatctcc
tcggtgcacggactgcgcgccagcccgtacaagtcggcctacgtggcggccaagcacgcg
ctggaggggctgagcaaggtggtcgcgctggaagccgccccgcacggggtgaccagcaac
tgcgtcaaccccggctacgtccgcaccccgctggtcgagcggcagatcgccgcccaggcc
gaggcgcacggcatcggcgaggacgaggtggtgcgcgaggtgatgctggaacgcaccgcg
atcaaacggctcatcgagcccgaggaggtcgccgcggtcgtgctgtggctgtgcggcccc
cacagcggctacctgaccggcgcctcggtcccggtggacggcggctggacggcgcactga

DBGET integrated database retrieval system