KEGG   Streptomyces cattleya NRRL 8057: SCAT_5710Help
Entry
SCAT_5710         CDS       T01646                                 

Gene name
strK
Definition
Streptomycin-6-phosphate phosphatase
Orthology
K04342  
streptomycin-6-phosphatase [EC:3.1.3.39]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Streptomycin biosynthesis
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SCAT_5710 (strK)
Enzymes [BR:sct01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.39  streptomycin-6-phosphatase
     SCAT_5710 (strK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6148697..6150055)
Genome map
AA seq 452 aa AA seqDB search
MPRPTRRHLTVATALIAATTAAVAVTTTAGAFDGKDRAKSAIQGGKARNVILLIGDGMGD
SEITLARDYTVGANGRLNMDAFPLTGAYTTYAVHADGTPDYVTDSAASGTGWATGVKTVN
GRVSKTPGTDKPVRTLLELAQRNGYATGDVTTAELTDATPAVLASHVTDRSCQGPADMAK
CPTDTIAAGGPGSIAEQEVGHKVDVLFGGGRQRFDQKVTDGRYKGLTVTEQARRLGYRVV
TDDASMKAAEPGRPVLGLFAPGNVPTEWTGKPAAVGGTDPQRCVTSNPGRPAATPSLADS
AAKAIRLLEAKQKHSRQGFFLQIEGASIDKQDHAADPCGQIGETAAFDKAVRVARAYAAQ
HPDTLVVTTADHGHTSQIVPLEATPPGLSATLVTNEGQQLKVNYSTNTPGRSQEHTGTQV
RIAAQGPLAYRVLGVTNQTDLFTTVREALRLR
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcccagacccacccgccgtcacctcaccgtcgccaccgcgctgatcgcggccaccacg
gccgccgtggccgtgaccaccaccgccggcgccttcgacggcaaggaccgggcgaagtcc
gcgatccagggcgggaaggcgaggaacgtcatcctgctcatcggcgacggcatgggcgac
tcggagatcaccctcgcccgggactacacggtcggcgccaacggccgcctgaacatggac
gcgttcccgctcaccggcgcgtacaccacgtacgccgtgcacgccgacggcacgccggac
tacgtcaccgactccgccgccagcggcaccggctgggccaccggcgtgaagacggtcaac
ggacgcgtctccaagacccccggcaccgacaagccggtgcgcaccctgctggagctggcc
cagcgcaacggctacgccaccggtgacgtcaccaccgccgaactcaccgacgccaccccg
gcggtgctcgcctcgcacgtgaccgaccgctcctgccagggcccggccgacatggccaag
tgccccaccgacaccatcgccgcgggcgggccgggctccatcgccgagcaggaggtcggt
cacaaggtcgacgtcctcttcggcggcggcaggcagcgcttcgaccagaaggtcaccgac
ggcaggtacaagggcctcaccgtcaccgagcaggcacgcaggctcggttaccgggtcgtc
accgacgacgcgtcgatgaaggcggccgagccggggcggccggtcctcggtctcttcgcc
cccggcaacgtgcccaccgagtggaccggcaagccggccgcggtcggcggcacggacccg
cagcggtgcgtcacctccaaccccggccgcccggcggccaccccgagcctggccgactcc
gcggcgaaggccatccgcctgctggaggccaagcagaagcactcccggcagggcttcttc
ctccagatcgagggcgcctccatcgacaagcaggaccacgccgccgacccctgcggccag
atcggcgagaccgccgccttcgacaaggcggtgcgggtcgcccgcgcctacgccgcccag
caccccgacaccctcgtcgtcaccaccgccgaccacggccacaccagccagatcgtcccg
ctggaggccaccccgcccgggctctccgccaccctcgtcaccaacgagggccagcagctg
aaggtcaactactcgaccaacaccccgggccggtcccaggagcacaccggcacccaggtc
cgcatcgccgcccagggcccgctggcctaccgcgtcctcggcgtcaccaaccagaccgac
ctgttcaccaccgtccgcgaggcgctgcggctgcgctga

DBGET integrated database retrieval system