KEGG   Streptomyces cattleya NRRL 8057: SCAT_p0031Help
Entry
SCAT_p0031        CDS       T01646                                 

Definition
carbohydrate kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SCAT_p0031
Enzymes [BR:sct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SCAT_p0031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSCAT:27700..28617
Genome map
AA seq 305 aa AA seqDB search
MDEYDLLVVGSANADLVIGVERRPAAGETVLGSDLAVHPGGKGANQAVAAARLGARTALL
ARVGDDAHGRLLLDAQRAAGVDPVGVLVGGAPTGVALITVDPSGDNSIVVSPGANGRLTP
EDVRAAAGLFQASRVVSAQLEVPLETVVEAVRHLAPGSRFVLNPSPPRPLPRELLEACDP
LIVNEHEAKVILAGADGSGADVGEDPQGWARALLALGPRSVVVTLGAEGALVAWPERVVR
VPSVTVDAVDTTGAGDAFTAALACRLGAGASLQEAARYAARVGAVAVTRHGAQESYPTAA
EVDAL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggacgagtacgacctgctggtcgtggggtcggccaacgccgacctggtgatcggcgtc
gagcggcggcccgcggccggcgagacggtgctcggttcggacctggccgtccaccccggc
ggcaagggcgccaaccaggcggtggccgccgcccggttgggggcccgtacggcactgctg
gcccgggtcggcgacgacgcacacggccggctgctgctcgacgcgcagcgcgcggccggg
gtggacccggtgggcgtgctggtgggcggggcgcccaccggggtggcgctgatcacggtg
gacccgtccggggacaacagcatcgtggtctcgccgggtgccaacggccggctcacgccc
gaggacgtgcgggcggcggccgggctcttccaggcatcccgggtggtctccgcgcagttg
gaggtcccgttggagacggtcgtggaggcggtacggcacctggctcccggcagccgtttc
gtgctcaacccctccccgccgcgtccgctgccgcgggaactgctggaggcctgcgacccg
ctgatcgtcaacgagcacgaggccaaggtgatcctcgccggggcggacgggagcggcgcg
gacgttggcgaggatccgcaagggtgggcgcgggcgctgctcgccctcggcccgcgctcg
gtggtcgtcaccctgggcgccgagggcgcgctggtggcgtggcccgagcgggtggtcagg
gtgccgtcggtgacggtggacgccgtggacaccacgggcgcgggcgacgcgttcaccgcg
gcgctggcctgccggctgggcgcgggagcgtccttgcaggaggcggcccgctacgcggcc
cgggtgggcgcggtggccgtcaccaggcacggcgcgcaggagtcctaccccacggcggcg
gaggtcgacgcgctgtga

DBGET integrated database retrieval system