KEGG   Streptomyces cattleya NRRL 8057: SCAT_p0136Help
Entry
SCAT_p0136        CDS       T01646                                 

Gene name
xlnA
Definition
Endo-1,4-beta-xylanase A
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
sct  Streptomyces cattleya NRRL 8057
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSCAT:144352..145824
Genome map
AA seq 490 aa AA seqDB search
MPLGRTLIRLHHAWALAVALALVLATGALAATTPAVAAGSTLKAAAESDGRYFGTALTDA
DLGVTGETTVAGTQFDMLTPGNEMKWDTTEPSNGSYNFGPGDQLVRFAQAHGMRVRGHNL
VWQSQLPAWVRNLPLNQVRSAMESHITTEATHYKGQVYAWDVVNEPFNADGSLVGDVFYQ
AMGSGYLADALRTAHAADPGAKLYINDYGIEGENAKSDALYRLAQSLLSQGVPLGGIGFE
SHFVLGQIPADMRANMERFANLGLDVAVTELDDRVQLPASGSALQQQSTDFGAVVRDCLA
VTRCVGVSQWGVDDAHSWIPGAFPGYGAATMYDGNDQPKPAYGAALSALGGSNPGGGGGT
TGELRAVGAGKCLDVPGGSTAAGTQVQIYGCWGGTNQLWTRTPSGQLTVYGGSGQLCLDA
QGQGAVPGTKVVTWPCNGQANQQWRFNADGTVTGVQSGLCLDVTGASTADGALAQLWTCT
GHTNQQWTLG
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgcctctcggaaggaccctgatcagacttcaccacgcctgggccttagcggtcgccctg
gcgctggtcctcgcgaccggtgcactggccgcgacgacaccggccgtcgcggccggcagc
acgttgaaggcggcggcggagtcggacggccggtatttcggcaccgcgctgaccgacgcc
gacctcggcgtcaccggtgaaaccaccgtcgccgggacacagttcgacatgctgaccccc
ggcaacgagatgaagtgggacaccaccgagccgtccaacggctcgtacaacttcggtccg
ggcgaccagctcgtacggttcgcccaggcacacggcatgcgggtgcgcggtcacaacctg
gtctggcagagccagttgcccgcctgggtgaggaacttgccgctgaaccaggtgcgctcc
gccatggagtcgcacatcaccaccgaggccacccactacaaggggcaggtctacgcgtgg
gacgtggtcaacgagccgttcaacgccgacggctccctcgtcggggacgtgttctaccag
gcgatggggtccggttatctcgccgacgcgctgcgcaccgcgcacgccgccgacccgggc
gccaagctctacatcaacgactacggcatcgagggtgagaacgcgaagagcgacgccctc
taccgcctcgcgcagtcgctcctctcccagggcgtaccgctgggcggcatcgggttcgag
agccacttcgtcctcggccagatccccgccgacatgcgggccaacatggagcgcttcgcg
aacctgggcctggacgtggccgtcaccgaactggacgaccgcgtccagctccccgcctcc
ggctccgccctccaacagcagtccaccgacttcggcgccgtggtgcgcgactgcctggcc
gtcacccgctgcgtgggcgtgagccagtggggcgtggacgacgcgcactcctggatcccc
ggtgccttccccggctacggcgccgccaccatgtacgacggcaacgaccagcccaagccg
gcctacggcgcggcgctctccgcgctgggcggatcgaaccccggcggaggcggtggcacc
acgggtgagttgcgtgcggtgggtgcgggcaagtgccttgacgtgccgggtggttcgacc
gcggcaggtacccaggtgcagatctacggctgctggggcggtaccaaccagttgtggacc
cgtaccccgtccggccagttgaccgtgtacgggggcagtggccagttgtgcctggacgcc
caggggcagggcgccgtccctggtaccaaggtggtcacctggccctgcaacggccaggcc
aaccagcagtggcgcttcaacgccgacggcaccgtcaccggcgtccagtccggcctgtgc
ctcgacgtcaccggcgcctccaccgccgacggcgccctggcccagctgtggacgtgcacc
ggccacaccaaccagcaatggaccctcggctga

DBGET integrated database retrieval system