KEGG   Streptomyces cattleya NRRL 8057: SCAT_p0443Help
Entry
SCAT_p0443        CDS       T01646                                 

Gene name
melA
Definition
alpha-galactosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sct00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sct00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSCAT:complement(512336..513646)
Genome map
AA seq 436 aa AA seqDB search
MTHPKITFIGAGSVVFTQGLLADIFAFPELGGCHVALHDIDAERLSTAEAAARRIAESRG
VKPVITAHLDRRAALDGADFVVNMVQVGMNEATRTDFEIPASFGLRQTIGDTLGVGGIFR
ALRTFPLLHGLGHDMAEVCPDAWLLNYTNPMVMNVGYLTAATPLRRVVGLCHSVYWTMHD
LSALVGVPFEEVSYLAAGVNHQSWVLRFERAGQDLYPLLDQAIEKDPELRRRVRVDMYRR
LGHYPTETSEHSSEYVPWYLHHDSEVERLRLPIGEYLRIVEENLAQYHATRDALDAGHPL
PVEGSMEYAPQIIHSIVTGTPRTVYGNVPNRGLVDNLPSDGVVEVPCLVDSLGVQPTRVG
SLPPQCAALNRNYLGVTDLVVRAAVEDDPRHIRHAAMADPATAATLTVEQIWELCDAMVR
AHGERLQPGLRAVLGH
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgacccacccgaagatcaccttcatcggggccggcagcgtcgtcttcacccaaggactg
ctcgccgacatcttcgccttccccgaactcggcggctgccacgtcgcgttgcacgacatc
gacgccgaacgcctcagcacggccgaggccgccgcccgccgcatcgccgagtcccgcggc
gtcaagccggtgatcaccgcccacctggaccggcgggcggcgctcgacggtgccgacttc
gtcgtcaacatggtgcaggtcggcatgaacgaggccacccgcaccgacttcgagatcccc
gcctccttcgggctgcgccagaccatcggcgacaccctcggcgtcggaggcatcttccgc
gcgctgcgcaccttcccgctgctgcacgggctcggccacgacatggccgaggtctgcccg
gacgcctggctgctgaactacaccaacccgatggtgatgaacgtcggctacctgaccgcg
gccaccccgctgcgccgggtggtcggactgtgccactcggtgtactggacgatgcacgac
ctgtccgcgctggtcggcgtacccttcgaggaggtctcctacctcgccgccggggtcaac
caccagtcgtgggtgctgcgtttcgaaagggccgggcaggacctctacccgctgctggac
caggccatcgagaaggacccggaactgcgccgccgggtacgggtcgacatgtaccgccgg
ctcggccactaccccaccgagaccagcgagcactcctccgagtatgtcccgtggtacctc
caccacgacagcgaggtggaacggctgcggctgccgatcggggagtacctgcgcatcgtc
gaggagaacctcgcccagtaccacgcgacccgtgacgcgctcgacgccggccacccgctg
ccggtcgaaggcagcatggagtacgccccgcagatcatccacagcatcgtcaccggcacc
ccgcgcaccgtctacggcaacgtgcccaaccgcggtctggtggacaacctgccgtcggac
ggcgtggtggaggtgccgtgcctggtcgactcgctcggcgtccagccgacccgggtcggc
tcgctgcccccgcagtgtgccgcgctcaaccgcaactacctcggggtgaccgacctggtg
gtgcgggcggcggtggaggacgacccgcggcacatcaggcacgccgccatggcggacccg
gcgaccgccgccacgctgaccgtggagcagatctgggagttgtgcgacgcgatggtgcgt
gcccacggcgagcggctccagccggggctgcgcgcggtgctgggccattga

DBGET integrated database retrieval system