KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_p0472Help
Entry
SCAT_p0472        CDS       T01646                                 

Definition
(GenBank) putative Profilin-1A
  KO
K05759  
profilin
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
Brite
Cytoskeleton proteins [BR:sct04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     SCAT_p0472
Exosome [BR:sct04147]
 Exosomal proteins
  Proteins found in most exosomes
   SCAT_p0472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
pSCAT:complement(542644..543027)
Genome map
AA seq 127 aa AA seqDB search
MNTVWQQYVDRHLVGTRQMRHGAILGLNGSTWGASAGFAVRPDEGRSLALLLGERSIAGR
VFTVGGARYTAGRCDPHVVHGTNSDSGLVALQARGALVVGVYDGRDVPERAREAVEKLAR
RLLDDRG
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgaacacggtgtggcagcagtacgtggaccggcatctggtgggcaccaggcagatgcgg
cacggggcgatcctggggctcaacgggagtacgtggggcgcgtcggccgggttcgccgtc
cggccggacgagggacgttcgctcgccctgctcctcggtgaacgctccatcgccggacgg
gtgttcaccgtgggcggcgcccggtacaccgccggccgctgcgacccgcacgtggtgcac
ggcaccaacagcgacagcggcctggtcgccctccaggcccgtggagcgctggtcgtcggc
gtctacgacggccgggacgtgcccgagcgcgccagggaggccgtcgagaaactggcccgg
cgcctcctcgacgaccggggctga

DBGET integrated database retrieval system