KEGG   Streptomyces cattleya NRRL 8057: SCAT_p0472Help
Entry
SCAT_p0472        CDS       T01646                                 

Definition
Profilin-1A
Orthology
K05759  
profilin
Organism
sct  Streptomyces cattleya NRRL 8057
Brite
Exosome [BR:sct04147]
 Exosomal proteins
  Proteins found in most exosomes
   SCAT_p0472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSCAT:complement(542644..543027)
Genome map
AA seq 127 aa AA seqDB search
MNTVWQQYVDRHLVGTRQMRHGAILGLNGSTWGASAGFAVRPDEGRSLALLLGERSIAGR
VFTVGGARYTAGRCDPHVVHGTNSDSGLVALQARGALVVGVYDGRDVPERAREAVEKLAR
RLLDDRG
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgaacacggtgtggcagcagtacgtggaccggcatctggtgggcaccaggcagatgcgg
cacggggcgatcctggggctcaacgggagtacgtggggcgcgtcggccgggttcgccgtc
cggccggacgagggacgttcgctcgccctgctcctcggtgaacgctccatcgccggacgg
gtgttcaccgtgggcggcgcccggtacaccgccggccgctgcgacccgcacgtggtgcac
ggcaccaacagcgacagcggcctggtcgccctccaggcccgtggagcgctggtcgtcggc
gtctacgacggccgggacgtgcccgagcgcgccagggaggccgtcgagaaactggcccgg
cgcctcctcgacgaccggggctga

DBGET integrated database retrieval system