KEGG   Streptomyces cattleya NRRL 8057: SCAT_p0588Help
Entry
SCAT_p0588        CDS       T01646                                 

Definition
hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sct00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:sct00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSCAT:659424..660968
Genome map
AA seq 514 aa AA seqDB search
MSSSNHSSELRRLALSVLQPGFEGTEAPDWVLRAIGEGLGSVVLFARNIATPEQVARLTA
RLRAENPELVIAIDEEAGDVTRIESWTGSTRPGNFALGAVDDVELTESVARDLGRELHAA
GVSLDYAPSVDVNSNPDNPVIGVRSFGTGTELVSRHAAAWIRGLQSAGVAACAKHFPGHG
DTAVDSHHGLPRYEADAEEIAARALPPFRAALQAGVRAVMSAHLLVPAYDRDLPATLSSS
VLEELLRKELGFDGLIVTDGIEMGAVADRYGIDGATVRAIAAGADAICVGGESADQGTTE
LLAEALAAAVVRGDLAEERLAEAAGRLRAFAAWSTGLGRSVPVDPVGGDIGFTAARRAVR
LTGPVHDVLPLTTAPHVVELVPATNLAIGKETPWGVAVPLRERLPGTTFVRVHQRQLAAD
AGFLDAHALAPASGRPLVVVVRDASRHAWMERALGTLATARPDAIVVEMGLPGAPHPGAV
RIDTCGATAASGVAAAEILAGAGHTVPARTAEPV
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccagtaaccacagcagcgagttgcggcgcctggcgctctccgtcctccagccg
ggcttcgagggcaccgaggcgccggactgggtgctgcgcgcgatcggtgagggcctcggc
tcggtcgtcctcttcgcccgcaacatcgccacccccgagcaggtggcccggctcaccgcc
cgactgcgcgccgagaaccccgagttggtcatcgcgatcgacgaggaggccggcgacgtc
acccgcatcgagtcctggaccggctccacccgccccggcaacttcgccctcggcgccgtg
gacgacgtcgaactcaccgagtccgtcgcccgcgacctcggccgcgaactccacgccgcc
ggggtcagcctggactacgcgcccagtgtcgacgtcaactccaaccccgacaacccggtc
atcggcgtgcggtcgttcggcaccggcacggaactggtctcccggcacgccgccgcctgg
atccgcggcctccagtcggccggcgtggccgcctgcgccaagcacttccccggccacggt
gacaccgccgtcgactcccaccacggactgccgcggtacgaggccgacgccgaggagatc
gccgcgcgggcgctgcccccgttccgcgccgcgctccaggcgggggtgcgcgcggtgatg
agcgcccacctcctggtgcccgcctacgaccgcgacctgccggccaccttgagcagcagc
gtcctggaagaactgctccgcaaggaactgggcttcgacggcctgatcgtcaccgacggc
atcgagatgggcgcggtcgccgaccgctacggcatcgacggggccacggtccgcgccatc
gcggccggcgccgacgccatctgcgtgggcggcgagagcgccgaccagggcaccaccgaa
ctcctcgccgaggcgctggcggctgccgtggtccgcggcgacctggccgaggaacgcctc
gccgaggcggccggacgcctgcgtgccttcgccgcctggtcgacggggctgggccggtcc
gtacccgtggacccggtcggcggcgacatcggtttcaccgcggcccgccgcgccgtgcgg
ctgaccggccccgtccacgacgtcctgccgctgaccaccgcgccgcacgtggtggaactg
gtgcccgccaccaacctcgccatcggcaaggagaccccgtggggcgtggccgtcccgctg
cgcgaacggctccccggaaccaccttcgtccgggtgcaccagcggcagctggcggccgac
gccgggttcctggacgcgcacgcgctggcgcccgcctcgggacgcccgctggtcgtcgtg
gtgcgggacgcctcccggcacgcgtggatggagcgcgccctgggcaccctggccaccgcc
cgccccgacgccatcgtggtggagatgggcctgcccggcgcaccgcacccgggcgcggtg
cgcatcgacacctgcggtgccaccgcggcgtccggggtggccgccgcggagatcctggcg
ggcgcgggacacacggtgccggcgcggaccgccgagcccgtgtga

DBGET integrated database retrieval system