KEGG   Streptomyces cattleya NRRL 8057: SCAT_p0756Help
Entry
SCAT_p0756        CDS       T01646                                 

Gene name
caiD
Definition
carnitinyl-CoA dehydratase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SCAT_p0756 (caiD)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SCAT_p0756 (caiD)
   00650 Butanoate metabolism
    SCAT_p0756 (caiD)
  Lipid metabolism
   00071 Fatty acid degradation
    SCAT_p0756 (caiD)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCAT_p0756 (caiD)
   00310 Lysine degradation
    SCAT_p0756 (caiD)
   00360 Phenylalanine metabolism
    SCAT_p0756 (caiD)
   00380 Tryptophan metabolism
    SCAT_p0756 (caiD)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCAT_p0756 (caiD)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SCAT_p0756 (caiD)
   00281 Geraniol degradation
    SCAT_p0756 (caiD)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SCAT_p0756 (caiD)
   00627 Aminobenzoate degradation
    SCAT_p0756 (caiD)
   00930 Caprolactam degradation
    SCAT_p0756 (caiD)
Enzymes [BR:sct01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SCAT_p0756 (caiD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSCAT:841036..841821
Genome map
AA seq 261 aa AA seqDB search
MSQTPTADDAPVLTEERDGVLLITLNRPHAKNAVDRAMAQALAAALDRLTEESALRAGVL
TGAGGDFSAGMDLKAFARGETPVLPGRGFGGLTRATLPKPLVAAVEGWALGGGTEMVLAC
DLVTASTEARFGLPEVTRGIVAPEGGLLRLPQRIPRNIAAELLLTGAPLTAPRAAELGLV
NRLTDPGGAVAAALELASATARNAPLSIAAVKHVLHEAVGMAEADAFRLQDEIIAPVLRS
EDAAEGPRAFAEKRPPRWRGR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagaccccgaccgccgacgacgccccggtgctcaccgaggaacgcgacggcgtc
ctgctgatcacgctcaaccggccgcacgcgaagaacgccgtggaccgggccatggcgcag
gcgctcgccgccgcgctcgaccgcctcaccgaggagtccgcgctgcgcgccggtgtactg
accggggccggcggggacttcagcgccgggatggacctcaaggcgttcgcgcgcggtgag
accccggtgctgccgggccgtggcttcggcggactgacccgcgcgacgctgcccaagccg
ctggtcgcggccgtcgaggggtgggcgctgggcggcggcaccgagatggtgctcgcctgc
gacctggtgaccgcctccaccgaggcccggttcgggctgccggaggtcacccggggcatc
gtcgccccggaaggcggcctgctgcggctgccgcaacgcatcccgcgcaacatcgcggcc
gaactcctgctcaccggcgccccgttgaccgcgccgcgcgccgcggaactggggctggtc
aaccggctgaccgatcccggcggggcggtcgcggcggcgctggagctggcctcggcgacg
gcccgcaacgcaccgctgtccatcgccgccgtcaagcacgtgctccacgaggcggtgggc
atggcggaggcggacgccttccggctccaagacgagatcatcgccccggtgctgcgttcc
gaggacgcggcggaggggccgcgtgccttcgccgagaagcgtccgccgaggtggcggggc
cggtga

DBGET integrated database retrieval system