KEGG   Streptomyces cattleya NRRL 8057: SCAT_p0862Help
Entry
SCAT_p0862        CDS       T01646                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SCAT_p0862
Enzymes [BR:sct01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SCAT_p0862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSCAT:952249..953382
Genome map
AA seq 377 aa AA seqDB search
MGTATTAAPPPGPLTGFTIGVTATRRREELVALLRRRGARVVEAPTLRIVPLDDDAALRR
ATERCLAAPLDYVVATTGLGWRGWMSAADGWGLAAGLAAACRGAAVLTRGPKATGAVRAS
GLAETYSPGSEATGELLRWLLARELAGRRVAVQEHGAPLDGFAAALRDRGAEVIEVPVYR
WGPPEDPEAVRRLVELTVRREVHALTFTSAPAIDALLRCADSAGRRAQVLAALGGDVLAA
CVGPLCARPLLDLGIHAVVPERGRLGALVRTLAERLPARGRVELVSGALRVVLQGDAVVV
DDGAVTLPPMLAALLRALAEQPGRVLSRAELLRRVWGSGQADEHAVEAAVARLRGALGAH
AGLVRTVPKRGYRLAVG
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgggtactgccacgaccgccgcgccgccgccgggaccgctgaccggtttcaccatcggc
gtgaccgcgacgcgccgccgcgaggagctggtggccctgctgcgccgccgtggcgcccgg
gtggtcgaggcgcccaccttgcggatcgtcccgctggacgacgacgccgcgcttcgccgg
gccaccgagcgctgcctggccgcgccgctggactacgtggtggccaccaccgggctcggc
tggcgcggctggatgagcgccgccgacgggtgggggctggccgccgggctcgccgcggcc
tgccggggggccgccgtgctcacccgtggccccaaggcgaccggggcggtacgcgcctcg
gggctggccgagacgtattcgccgggctcggaggccaccggtgagctgctgcgctggctg
ctggcgagggagctggccggccgccgggtcgcggtgcaggagcacggcgccccgctcgac
ggcttcgccgcggcgctgcgggaccgtggcgccgaggtgatcgaggtgccggtctaccgc
tggggcccgccggaggacccggaggcggtgcgccgcctggtggagctgacggtgcggcgg
gaggtgcacgcgctgacgttcaccagcgccccggcgatcgacgcgctgctgcggtgcgcc
gactccgccggacggcgggcgcaggtgctcgccgcgctcggcggtgacgtgctcgccgcg
tgcgtgggcccgctgtgcgcccggcccctgctcgacctgggtatccacgcggtggtgccg
gaacgcggccggctcggcgcgctcgtccgcaccctcgccgaacgcctcccggcgcgtggc
cgggtcgaactggtcagcggggcgctgcgcgtcgtcctccagggcgacgcggtggtggtg
gacgacggggcggtgacactgccgccgatgctggccgcgctgctgcgggcgctggccgag
caacccggccgggtgctcagccgggccgaactcctgcgccgcgtctggggttccggccag
gccgacgaacacgccgtggaggccgcggtggcccggctgcgcggcgcgctgggcgcccac
gccgggctggtccgcacggtgcccaagcgcggctaccggctcgcggtgggctga

DBGET integrated database retrieval system