KEGG   Streptomyces cattleya NRRL 8057: SCAT_p1409Help
Entry
SCAT_p1409        CDS       T01646                                 

Definition
sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCAT_p1409
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCAT_p1409
   00052 Galactose metabolism
    SCAT_p1409
   00500 Starch and sucrose metabolism
    SCAT_p1409
   00520 Amino sugar and nucleotide sugar metabolism
    SCAT_p1409
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SCAT_p1409
   00524 Butirosin and neomycin biosynthesis
    SCAT_p1409
Enzymes [BR:sct01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SCAT_p1409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSCAT:complement(1487106..1488044)
Genome map
AA seq 312 aa AA seqDB search
MTRPLTHPTVVAGVDIGGTTTQVVLCTPDLAVVAHTQIPTPAAQGGPAMIRAALDALRRL
LGQSPRRLAGVGVGAAGVVDTATGRVLVASDSFRDWAGFPVTATIEAELGVPAFLDNDVN
AFLRGEVAKGAVQGERDVLGITLGTGVGGALCLGGTLLDGAHGAAGEIGHIPGFGDLPCT
CGGRGHLETLASGRAVATHYARRTGHRTTARHIAAAAENGDADARAVFHAAGTAVARAVL
ITAGLLDVTTVVLGGGLTHAWHLLHPAIRQALEAEPPVSAQPIRLERTRLAGHAAAIGAA
CLAGPRPAPVGA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgacccctgacacaccccacggtcgtcgccggcgtcgacatcggcggcaccacc
acgcaggtggtgctgtgcacccccgacctggccgtagtggcgcacacccagatccccacc
ccggcggcccagggcggcccggcgatgatccgcgccgccctcgacgcgctgcgccggctg
ctcggccagtcgccccgcaggctggcgggcgtgggggtcggcgcggccggggtggtggac
accgcgaccggccgcgtcctggtggccagcgactccttccgcgactgggccggcttcccg
gtcaccgccaccatcgaggccgaactgggcgtaccggcgttcctcgacaacgacgtcaac
gccttcctgcgcggcgaggtcgccaagggcgccgtccagggcgagcgcgacgtgctcggc
atcaccctcggcaccggtgtcggcggcgccctgtgcctgggcgggaccctgctcgacggg
gcgcacggcgcggccggggagatcggccacatccccggcttcggcgacctgccgtgcacc
tgcggcggacgcggccacctggagaccctcgcctccggccgcgccgtcgccacccactac
gcgcggcgtaccggacaccgcaccaccgcccggcacatcgccgccgcggcggagaacggt
gacgccgacgcccgggccgtcttccacgccgccggaaccgccgtcgcccgtgccgtcctg
atcaccgcgggcctgctcgacgtcaccaccgtggtcctcggcggcggcctcacccacgcc
tggcacctgctgcaccccgcgatccgccaggcgctggaggccgaaccgccggtcagcgcc
cagccgatccgcctggagcgcacccggctggccggtcacgcggcggccatcggcgcggcc
tgcctggccggtccgcgcccggcgccggtcggggcgtag

DBGET integrated database retrieval system