KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCAT_p1480Help
Entry
SCAT_p1480        CDS       T01646                                 

Definition
(GenBank) Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sct  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
sct00020  Citrate cycle (TCA cycle)
sct00310  Lysine degradation
sct01100  Metabolic pathways
sct01110  Biosynthesis of secondary metabolites
sct01120  Microbial metabolism in diverse environments
sct01130  Biosynthesis of antibiotics
sct01200  Carbon metabolism
Module
sct_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sct_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sct00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCAT_p1480
  Amino acid metabolism
   00310 Lysine degradation
    SCAT_p1480
Enzymes [BR:sct01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SCAT_p1480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl DA1-like
Motif
Other DBs
NCBI-ProteinID: CCB72504
UniProt: F8JKR6
Position
pSCAT:1577198..1578304
Genome map
AA seq 368 aa AA seqDB search
MADIRVPKLNNNDTGYQLVAWLVDEDEPVKPDQPVAEVETSKAVEELVSGAEGVLRRLLA
VGDACAPGEVIARVVEPGAPREEPPARPNAVTEAAAEDPGPVVTAPARELMDQLGIDPAR
LRELDVKIVKRADVERLAPEQDSADTRQLPVPQQAVARTVSRSHAEIPAAYTVIAVDAGP
AKAEVARQTTALGRLLGLPELLIAAVARLHAAHPLCFARLTGEHTVRIEERPHIGVTIDV
GKGLNVPVVKDADQLSFAELVEVTTAFRRTAVRGRFRESELSGATIGVTLHNAPDIVHAI
PMIFPGQTCALALSGVRPEVVPDGDGFRARDTVNLGLAYDHRVVNGKDAVDFLQDLKAAL
EHPEELTR
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtggctgacatccgcgtgcccaaactcaacaacaacgacaccggctaccagctggtggcc
tggctggtcgacgaggacgagccggtcaagcccgaccagccggtggccgaggtggagacc
tccaaggccgtcgaggagctggtgagcggggccgagggcgtcctgcgcagactactcgcg
gtgggtgacgcctgcgcgccgggggaggtcatcgcgcgggtggtcgagcccggcgccccg
cgcgaggagcccccggcacggccgaacgccgtcaccgaggccgccgccgaggaccccggg
ccggtggtcaccgccccggcccgggagctgatggaccaactcggcatcgacccggcccgg
ctgcgcgaactggacgtgaagatcgtcaagcgcgcggacgtcgaacggctcgcccccgaa
caggacagcgccgacacacgccaactgcccgtcccccagcaggcggtggcccgcaccgtg
agccgctcgcacgcggagatcccggccgcctacaccgtcatcgccgtcgacgccggcccg
gccaaggccgaggtggcccggcagaccaccgcgctcggccggctgctgggcctgcccgag
ctgctgatcgcggccgtcgcccggctgcacgccgcgcacccgctgtgcttcgcccggctg
accggcgaacacacggtgcggatcgaggaacggccgcacatcggcgtcaccatcgacgtc
ggcaagggactcaacgtcccggtggtcaaggacgccgaccaactctccttcgccgaactc
gtcgaggtgacgaccgcgttccggcgcaccgcggtgcgcggccggttccgcgagtcggag
ctgtccggcgccaccatcggcgtcaccctgcacaacgcccccgacatcgtgcacgcgatc
cccatgatcttccccgggcagacctgcgcgctggcgctgtccggcgtccggcccgaggtg
gtcccggacggtgacgggttccgcgcccgcgacaccgtcaacctcggactcgcctacgac
caccgggtcgtcaacggcaaggacgcggtggacttcctccaggacctcaaggcggccctg
gagcacccggaggaactcacccgctga

DBGET integrated database retrieval system