KEGG   Streptomyces cattleya NRRL 8057: SCAT_p1480Help
Entry
SCAT_p1480        CDS       T01646                                 

Definition
Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sct  Streptomyces cattleya NRRL 8057
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:sct01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sct00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:sct00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSCAT:1577198..1578304
Genome map
AA seq 368 aa AA seqDB search
MADIRVPKLNNNDTGYQLVAWLVDEDEPVKPDQPVAEVETSKAVEELVSGAEGVLRRLLA
VGDACAPGEVIARVVEPGAPREEPPARPNAVTEAAAEDPGPVVTAPARELMDQLGIDPAR
LRELDVKIVKRADVERLAPEQDSADTRQLPVPQQAVARTVSRSHAEIPAAYTVIAVDAGP
AKAEVARQTTALGRLLGLPELLIAAVARLHAAHPLCFARLTGEHTVRIEERPHIGVTIDV
GKGLNVPVVKDADQLSFAELVEVTTAFRRTAVRGRFRESELSGATIGVTLHNAPDIVHAI
PMIFPGQTCALALSGVRPEVVPDGDGFRARDTVNLGLAYDHRVVNGKDAVDFLQDLKAAL
EHPEELTR
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtggctgacatccgcgtgcccaaactcaacaacaacgacaccggctaccagctggtggcc
tggctggtcgacgaggacgagccggtcaagcccgaccagccggtggccgaggtggagacc
tccaaggccgtcgaggagctggtgagcggggccgagggcgtcctgcgcagactactcgcg
gtgggtgacgcctgcgcgccgggggaggtcatcgcgcgggtggtcgagcccggcgccccg
cgcgaggagcccccggcacggccgaacgccgtcaccgaggccgccgccgaggaccccggg
ccggtggtcaccgccccggcccgggagctgatggaccaactcggcatcgacccggcccgg
ctgcgcgaactggacgtgaagatcgtcaagcgcgcggacgtcgaacggctcgcccccgaa
caggacagcgccgacacacgccaactgcccgtcccccagcaggcggtggcccgcaccgtg
agccgctcgcacgcggagatcccggccgcctacaccgtcatcgccgtcgacgccggcccg
gccaaggccgaggtggcccggcagaccaccgcgctcggccggctgctgggcctgcccgag
ctgctgatcgcggccgtcgcccggctgcacgccgcgcacccgctgtgcttcgcccggctg
accggcgaacacacggtgcggatcgaggaacggccgcacatcggcgtcaccatcgacgtc
ggcaagggactcaacgtcccggtggtcaaggacgccgaccaactctccttcgccgaactc
gtcgaggtgacgaccgcgttccggcgcaccgcggtgcgcggccggttccgcgagtcggag
ctgtccggcgccaccatcggcgtcaccctgcacaacgcccccgacatcgtgcacgcgatc
cccatgatcttccccgggcagacctgcgcgctggcgctgtccggcgtccggcccgaggtg
gtcccggacggtgacgggttccgcgcccgcgacaccgtcaacctcggactcgcctacgac
caccgggtcgtcaacggcaaggacgcggtggacttcctccaggacctcaaggcggccctg
gagcacccggaggaactcacccgctga

DBGET integrated database retrieval system