KEGG   Sorangium cellulosum So0157-2: SCE1572_01290Help
Entry
SCE1572_01290     CDS       T02718                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
scu  Sorangium cellulosum So0157-2
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:scu00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:scu00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
326528..327859
Genome map
AA seq 443 aa AA seqDB search
MTVVIGNKEYFPGVGKIPYEGPESDNPVAFKWYDESRVVAGKPMKDHFKFAVCYWHTFCG
RGHDPFGPGTINFPWDEGKDPLTRARMKMDANFEFITKLGATHYCFHDIDLVEEGDSRAE
TSRRLQGIVEYAKQKQAQSGVKLLWGTANLFSNPRYMNGASTNPDFSVVAYAGAQLKDAL
DATIALNGENYVFWGGREGYMSLLNTDMKREKEHFARFLTMARDYARARGFKGTFFIEPK
PMEPSKHQYDFDAETVIGFLRQHGLDKDFKLNLETNHATLAGHTMEHEMQVAADAGMLGS
IDANRGDYQNAWDTDQFPYNINETVEMMLILLRSGGFQGGGVNFDAKRRRNSTDLIDTFH
GHIGGMDVFARALIIADDLIRKSPLESMRKARYASFDGGKGAEFEQGKLTLEQLAEIGNA
GGEVKLTSGQQELYENIVNRWIR
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcgtgattggaaacaaagagtacttccccggtgtcggcaagatcccctacgag
gggcccgagtccgacaaccccgtcgccttcaagtggtacgacgagagccgcgtcgtcgcc
ggcaagcccatgaaggaccacttcaagttcgccgtgtgttactggcacaccttctgtggt
cgtgggcacgaccccttcggtccggggacgatcaacttcccctgggacgaggggaaggac
ccgctgacccgcgctcgcatgaagatggacgcgaacttcgagttcatcaccaagctgggc
gcgacgcactactgtttccacgacatcgacctggtggaggagggcgacagccgcgccgag
acgtcgcgccgccttcagggcatcgtcgagtacgccaagcagaagcaagcgcagtcgggc
gtcaagctgctgtggggcacggcgaacctgttctccaacccgcgctacatgaacggcgcc
tccacgaacccggatttctccgtggtggcctacgccggcgcccagctgaaggacgccctc
gacgccaccatcgcgctgaacggtgagaactacgtgttctggggcggccgcgagggttac
atgagcctgctgaacacggacatgaagcgcgagaaggagcacttcgcgcgcttcttgacc
atggcgcgcgactacgcgcgcgcccggggcttcaaggggaccttcttcatcgagcccaag
ccgatggagccgtcgaagcaccagtacgacttcgacgccgagaccgtgatcgggttcctg
cgccagcacggcctggacaaggacttcaagctcaacctggagacgaaccacgcgacgctc
gctggccacaccatggagcacgagatgcaggtggccgcggacgccggcatgctcggcagc
atcgacgcgaaccgcggcgactaccagaacgcgtgggacaccgatcagttcccctacaac
atcaacgagacggtggagatgatgctcatcctcctccgcagcggcgggttccagggtggc
ggcgtcaacttcgacgcgaagcgccgccgcaactcgacggacctgatcgacaccttccac
ggccacatcggcggcatggacgtgttcgcccgcgcgctcatcatcgccgacgacctgatc
cgcaagtcgccgctcgagtcgatgcgcaaggctcgttacgcgtcgttcgacggcggcaag
ggcgcggagttcgagcaggggaagctcacgctggagcagctggccgagatcggcaacgcc
ggcggcgaggtcaagctcacgagcggtcagcaagagctgtacgagaacatcgtcaatcgg
tggatccggtaa

DBGET integrated database retrieval system