KEGG   Sorangium cellulosum So0157-2: SCE1572_02785Help
Entry
SCE1572_02785     CDS       T02718                                 

Definition
alpha-amylase
Orthology
K05343  
maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
scu  Sorangium cellulosum So0157-2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:scu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(745121..748516)
Genome map
AA seq 1131 aa AA seqDB search
MSQDQKPPPAEGSALWYKDAIIYELHVRAFSDSNADGIGDFEGLVDKLDYLQDLGVTAIW
LLPFYPSPLRDGGYDIADYANINPSYGTRREFARLLREAHRRDIRVITELVLNHTSNEHE
WFQRARTSPKGSRWRDFYVWSDTPHRYKDARIIFKDFETSNWAWDPVANAYYWHRFYSHQ
PDLNFENPEVHAAVFKVVDFWLEMGVDGLRLDAVPYLYERDGTNCENLPETHEFLRKLRR
HIDANFSDRMLLAEANQWPADAAAYFGNGDECHMNFHFPLMPRMFMAVELEDSFPIVNIL
KQTPVVHETCQWATFLRNHDELTLEMVTDEDRDYMYRVYAQEHTARINLGIRRRLAPLMK
TRRRIELMNALLFSLPGTPVLYYGDEIGMGDNIYLGDRDGVRTPMQWSADRNAGFSRANP
QKLYLPIIIDPEYHYEAINVEAQQQNPASLLWWMKRLITLRKQNKVLGRGTIEFLHPDNN
KVLAFIRAYGDERLLIVANLSRYAQHVELDLARFEGMVPVELFGRSRFPEITSRCYPLSL
GPHDFFWFALEPATPATSVGEAQAVPAISTRGSWRALLSPEGRRALEPALGKFIAARRWF
RGKARTRRATTLADVIPIQRSEQTAAEHYLLLVRIEYTDGSPETYVVPIGFATGDSARTL
ATRTRHAVIADVTVRDPEPEAAAAPEGVLYDALTTPEFAALILAAIRAQGVATGAAGELQ
ALPFGATLEALGAGGELPARVAESEQSNTTIIYGDKLLLKIFRQVEEGINPELEIGRFLT
DHQFPATARLAGAIEYKGRGREPTTVAMLQEYVQSQSDAWTSTLESLNRFFERVLTDEGS
VKGSVPPMPAGTLVDASRAAPPPVVNQLMGTELVRMRLLGERTAQLHLTLGGESKDPAFG
QQPFTTLHQQSIFQSAHGMLSRTFTLLRKRERSLPENVREQVSAMLQREAEINAKLQQIV
SRKFDVARIRTHGDFHLGQVLSTGDDFILIDFEGEPARPLSERRYKRGPLRDVGGMVRSF
DYAGASALRDARLRPEDVTVLKPWTDAWVAWISASYLAGYLETIARAQASAEPRADETAP
YVPASDADTALLLDFYQLEKCIYEVGYELNNRPDWLDIPLRGLERLITPGV
NT seq 3396 nt NT seq  +upstreamnt  +downstreamnt
atgagccaggatcagaagccccctcccgccgaaggcagcgccctctggtacaaggacgcg
atcatctacgagctccatgtccgcgcgttcagcgactcgaacgccgacggcatcggcgac
ttcgaggggctcgtcgacaagctcgactacctccaggatctcggcgtcactgcgatctgg
ctcctgccgttttacccgtcgccgctgcgcgacggcggatacgacatcgcggactacgcg
aacatcaacccgtcttacgggacgcggcgcgagttcgcccgcctgctgcgcgaggcgcac
cgccgcgacatccgcgtcatcaccgagctcgtcctgaaccacacctcgaacgagcatgag
tggttccagcgggcgcggacctcgcccaagggctcgcgctggcgcgacttctacgtctgg
agcgacacgccccaccgctacaaggacgcccggatcatcttcaaggatttcgagacgtcg
aactgggcgtgggatccggtggccaacgcctattactggcaccgcttctactcccaccag
cccgacctcaacttcgagaacccggaggtgcacgccgccgtgttcaaggtggtcgacttc
tggctcgagatgggcgtcgacgggctgcggctcgacgccgtgccgtacctctacgagcgc
gacggcacgaactgcgagaacctgccggagacgcacgagttcttgcggaagctccggcgg
cacatcgacgcgaacttctccgatcgcatgctcctcgccgaggccaaccagtggcccgcc
gacgccgcggcgtacttcggcaacggcgacgagtgccacatgaacttccacttcccgctc
atgcccaggatgttcatggcggtggagctcgaggacagcttcccgatcgtcaacatcctg
aagcagacgcccgtggtccacgagacctgccagtgggcgacgttcctccggaaccacgac
gagctcacgctcgagatggtgaccgacgaggaccgggactacatgtaccgcgtctacgcg
caggagcacaccgcgcggatcaacctgggcatccggcggcggctcgccccgctcatgaag
acgcggcgccggatcgagctgatgaacgcgctgctcttctcgctgccggggacgcccgtc
ctctattacggcgacgagatcgggatgggcgacaacatctatctcggcgaccgcgacggc
gttcgcacgccgatgcagtggagcgccgaccggaacgccggcttctcccgggcgaacccg
cagaagctctacctgccgatcatcatcgaccccgagtaccactacgaggcgatcaacgtc
gaggcgcagcagcagaaccccgcctcgctcctctggtggatgaagcggctcatcaccctg
cgcaagcagaacaaggtgcttggccgcggcacgatcgagttcctgcacccggacaacaac
aaggtgctcgcgttcatccgcgcgtacggggacgagcggctgctcatcgtggcgaacctg
tcgcggtacgcgcagcacgtcgagctcgacctcgcgcgcttcgagggcatggtgcccgtc
gagctgttcggccggagccgcttcccggagatcacgagccgctgctacccgctgtcgctc
gggccgcacgacttcttctggttcgcgctggagccggcgacgccggcgacgtccgtgggc
gaggcccaggcggtgcccgcgatctcgacgaggggctcgtggcgggcgctcctctcgccc
gaggggcgcagggcgctcgagccggcgctcgggaagttcatcgcggcgcggcgctggttc
cgcggcaaggcgcgcacccggcgcgcgacgacgctcgcggacgtcatcccgatccagcgc
agcgagcagacggcggcggagcactacctcctgctcgtgcgcatcgagtacacggacggc
tcgccggagacgtacgtcgtgccgatcggcttcgccacgggcgactccgcgcggacgctc
gccacgcggacgcgccacgcggtgatcgccgacgtcacggtgcgcgatccggagccggag
gccgcggcggcgccggagggcgtcctgtacgacgcgctgacgaccccggagttcgccgcg
ctcatcctcgccgcgatccgcgcgcagggcgtcgcgaccggcgccgccggcgagctccag
gcgctgccgttcggcgcgacgctcgaggcgctcggcgccgggggagagctcccggcgcgc
gtcgccgagagcgagcagagcaacaccaccatcatttacggcgacaagctgctcctcaag
atcttccggcaggtcgaggagggcatcaacccggagctcgagatcggcaggttcctgacc
gaccaccagttccccgcgacggcgcggctcgccggggcgatcgagtacaagggccgcggt
cgcgagccgaccacggtggcgatgctccaggagtacgtgcagagccagagcgacgcgtgg
acgagcacgctggagtcgctgaaccgcttcttcgagcgggtgctcaccgacgaggggtcg
gtgaaggggagcgtgccgccgatgccggccggcacgctcgtcgacgcgtcgcgcgcggcg
ccgcctccggtcgtgaaccagctcatgggcaccgagctcgtgaggatgcggctgctcggc
gagcgcaccgcgcagctccacctcacgctcggcggggagagcaaggaccccgcgttcggg
cagcagccgttcacgacgctgcaccagcagtcgatcttccagtcggcgcacggcatgctc
tcgcgcaccttcacgctgctccggaagcgcgagcgctcgctccccgagaacgtgcgcgag
caggtgtcggcgatgctgcagcgcgaggccgagatcaacgccaagctccagcagatcgtg
tcgaggaagttcgacgtcgcccgcatccggacgcacggcgacttccacctcggccaggtg
ctctcgacgggcgacgacttcatcctgatcgatttcgagggggagccggcgcggccgctg
agcgagcgccgctacaagcgcggcccgctccgggacgtgggcgggatggtgcgctcgttc
gactacgccggcgcctcggcgctccgggacgctcgcctccggcccgaggacgtcaccgtc
ctcaagccgtggaccgacgcctgggtggcgtggatctccgcgagctacctcgcgggatac
ctggagacgatcgcgcgcgctcaggcgagcgccgagccgcgggcggacgagacggcgccg
tacgtgcccgcgagcgacgcggatacggcgctcctgctcgacttctaccagctcgagaag
tgcatctacgaggtcggctacgagctcaacaaccggcccgactggctggacatcccgctg
cgcgggctggagcgtctgattacgcccggggtgtaa

DBGET integrated database retrieval system