KEGG   Sorangium cellulosum So0157-2: SCE1572_04100Help
Entry
SCE1572_04100     CDS       T02718                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
scu  Sorangium cellulosum So0157-2
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:scu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SCE1572_04100
Enzymes [BR:scu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SCE1572_04100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1158432..1159277)
Genome map
AA seq 281 aa AA seqDB search
MGLLAICGSITADLLGYGPRLPRPGESVLGRRFLVAPGGKGANQAVAAARSGARVRLAGA
RGDDAHGELCAAALAADGVDLSAVAIHRGATTGVALICVDDAGENQILAIPGANALVAPP
APCGASVWLCQGEIPAEAIAGVLSAARADGALSICNPSPVNAIDPALVGRFDLAVVNELE
HEALRGHLPERVVLTRGARGAVLLPSGEELPALPARAVDTTGAGDALAGVLAGGLASGMT
IEAALRIAIAAAGISVEREGCQPSYPTRAEVERRLGAASGP
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggggttgctcgcgatctgcggctcgatcaccgccgatctcctcggttacggcccgcgg
ctgccgcgcccgggcgagtcggtgctgggccgccgcttcctcgtcgcgccgggcggcaag
ggcgcgaaccaggcggtcgcggcggcgcgctccggcgcccgcgtgcggctcgcgggcgcg
cgcggcgacgacgcccacggcgagctctgcgccgccgcgctcgccgccgacggcgtggac
ctctccgccgtggcgatccaccgcggcgcgacgaccggcgtggccctcatctgcgtcgac
gacgccggggagaaccagatcctcgcgatccccggcgccaacgcgctcgtcgcgccgccc
gcgccgtgcggggcctcggtctggctgtgccagggcgagatcccggccgaggccatcgcc
ggcgtgctgtcggccgcgcgggcggacggcgcgctgtcgatctgcaatccatcgcccgtc
aacgccatcgaccccgcgctcgtcggccggttcgatctcgccgtggtcaacgagctcgag
cacgaggcgctgcgaggccacctgccggagcgcgtggtgctcacccgcggcgcccgcggc
gccgtgctgctgccctcgggcgaggagctgcccgccctccccgcgcgcgccgtcgacacg
accggcgcgggcgacgcgctcgcgggcgtgctcgccggcgggctcgcctccgggatgacc
atcgaggccgcgctgcgtatcgcgatcgcggcggcgggcatctcggtcgagcgcgagggg
tgccagccctcctatccgacccgcgccgaggtggagcgccgcctcggcgccgcctcgggc
ccgtga

DBGET integrated database retrieval system