KEGG   Sorangium cellulosum So0157-2: SCE1572_09655Help
Entry
SCE1572_09655     CDS       T02718                                 

Definition
hypothetical protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
scu  Sorangium cellulosum So0157-2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:scu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2662422..2663606)
Genome map
AA seq 394 aa AA seqDB search
MLGGSKWSFGLAAVALQAAVLIGCGDASTDDGVGGAGGAGGAGGGTTTGTTSTSASSTTS
VSSTTSVSSTTSVSSTTTGPGTTSSSTTSTGTGMVPTDGTPVERHGVLRVKDGNIVGEHG
APVQLKGMSLFWSQWSNYYNANVVNSLADNWKATVVRAAMGIENEGGYLEDAGGQKAKAK
AIADAAIGKGIYVILDWHDHNANNHLDQARSYFREVAQTYKNVPNVIFEVFNEPLNTHNW
QTVKSYAEAVIGEIRGQGANNLVIVGSPNWSQDADIAADNRINDPNVAYTLHFYAATHKS
ALREKAQRAMDKGLALFVTEWGTCDASGDGALDLGESGTWLNFLDAHNISWANWSLGDKA
EACSALKPRANTMGNWTDNDLTESGKWVKGKIAE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgcttggcgggtcgaagtggtcattcggcctcgcggcggtcgccctgcaagcagccgtg
ctgatcggctgcggcgacgcatcgacggatgacggcgtgggcggcgccggcggcgccggc
ggcgccggcggggggacgacgacggggaccacgtcgacctcggccagctcgacgacctcg
gtcagctcgacgacctcggtcagctcgacgacctcggtcagctccaccacgacggggccc
gggacgacctcgtcgtcgacgacgagcacgggcaccgggatggtgcccacggacggaacg
ccggtcgagcgccacggcgtgctccgggtcaaggacggcaacatcgtcggtgagcacggg
gccccggtccagctcaaaggcatgagcctgttctggagccagtggagcaactactacaac
gcgaacgtcgtcaactcgctcgccgacaactggaaggcgaccgtcgtgcgcgcggcgatg
ggcatcgagaacgaaggcggctacctcgaagacgcgggcggccagaaggccaaggcgaag
gccatcgccgacgcggcgatcgggaagggcatctacgtgatcctcgactggcacgatcac
aacgcgaacaaccacctcgatcaggcgaggagctacttccgcgaggtggcgcagacctac
aagaacgtgcccaacgtgatcttcgaggtcttcaacgagccgctcaacacgcacaactgg
cagaccgtgaagtcgtacgccgaggcggtgatcggcgagatccgcggccagggcgcgaac
aacctcgtcatcgtcggctcgccgaactggtcgcaggacgcggacatcgccgcggacaac
cgcatcaacgaccccaacgtggcgtacaccctgcacttctacgccgcgacgcacaagagc
gcgctgcgcgagaaggcccagcgcgcgatggacaagggcctggcgctgttcgtgaccgag
tgggggacgtgcgacgccagcggcgacggcgcgctcgatctcggcgagtcggggacctgg
ctcaacttcctcgacgcgcacaacatcagctgggccaactggtcgctaggcgacaaggcc
gaggcgtgctccgcgctgaagcccagggcgaacaccatgggcaactggaccgacaacgac
ctcaccgagtcgggcaagtgggtgaaggggaagatcgcggagtga

DBGET integrated database retrieval system