KEGG   Sorangium cellulosum So0157-2: SCE1572_13710Help
Entry
SCE1572_13710     CDS       T02718                                 

Definition
hypothetical protein
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
scu  Sorangium cellulosum So0157-2
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCE1572_13710
   00330 Arginine and proline metabolism
    SCE1572_13710
   00340 Histidine metabolism
    SCE1572_13710
   00350 Tyrosine metabolism
    SCE1572_13710
   00360 Phenylalanine metabolism
    SCE1572_13710
   00380 Tryptophan metabolism
    SCE1572_13710
Enzymes [BR:scu01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     SCE1572_13710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3834065..3835138)
Genome map
AA seq 357 aa AA seqDB search
MLDTAIIGGGVCGLSLSRSLSAVGADYQLFEARDRLGGRVLSVPAGPTRVDLGPTWFWPV
TQPLMSRLVDELELASFAQHDDGPIMVLSHPNKTPERYRGDTGLHGGGLRLVGGMGSLVD
ALAGAVPRERVHLGHVLEAVELDDAKVLLRFARGDGGLTVEARRVVLALPPRLLAENVRF
TPELPAPLRQAMTATPTWMAAQAKAVLTYRQPSWREDGLSGNAFVTHGQAVFGEIFDASD
PLHGLSALGAFLALPAGARARFAAELPLLIDKQIAQVFGEHLSRVEQHYKDWATDRFTCS
ARDREERPEHIGSGHPLLRQPYARGQVFFGAAETASYAAGYLEGALDAARRIRRDLA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacggcgatcatcggtggtggagtgtgcggcctgtcgttgtcgcggagcctg
tccgcggtgggtgcggactaccagctcttcgaggctcgggatcggctcgggggtcgcgtg
ctctctgttcctgccggcccaacgcgggtggacctggggcccacctggttctggcccgtc
acccagccgctcatgagccgcctcgtcgacgagctcgaactcgcgtccttcgcgcagcac
gacgacggaccgatcatggtcttgtcgcatcccaacaagacaccagagcgttacaggggc
gacacgggcctgcacgggggcgggctaaggctcgtgggaggaatgggcagcctggtcgat
gcccttgcgggggcggtgccgcgagagcgcgtgcatctcggtcacgtgctcgaggcggtc
gagctcgacgacgccaaggtgctgctccgctttgcgcgcggcgacggcgggctcacggtg
gaagcccgtcgcgtcgtgctcgcgctccctccgcgcctgctcgccgagaacgtccggttc
acgccggagctgccggcgccgctgcggcaagccatgacggcgacgcccacctggatggcg
gcgcaagccaaggcggtgctcacctaccggcagccgagctggcgcgaagacgggttgtcc
ggcaacgccttcgtgacccacggtcaggcggtgttcggcgagatcttcgacgcgtcggat
ccgctccatgggctcagcgcgctgggcgcgtttctggccctcccggccggagcgcgcgcg
cggtttgcggccgagctccccctcctcatcgacaagcagatcgcgcaggtgttcggcgag
catctgtcgcgtgtggagcagcattacaaggactgggcgaccgaccggttcacctgtagc
gcccgcgaccgcgaggagcgccccgagcacatcgggtcagggcaccccctgttgcggcag
ccgtacgctcgcgggcaggtgttcttcggcgccgccgagacggccagctatgcggccggc
tacctcgaaggcgcgctcgacgccgcacgccgcattcggcgtgacctcgcctga

DBGET integrated database retrieval system