KEGG   Sorangium cellulosum So0157-2: SCE1572_14365Help
Entry
SCE1572_14365     CDS       T02718                                 

Definition
hypothetical protein
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
scu  Sorangium cellulosum So0157-2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:scu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3993649..3995214)
Genome map
AA seq 521 aa AA seqDB search
MTVPLFSLRSDRSWGIGEIGDLPEFAAWMRGAGLRLVQLLPLGEVSGGETSPYMALSAFG
IDPMYISLSAVPELPPELHGEALGDDAAALDRAKQSARVDYDLVRRVKGRALRFAFDRFE
REHHAKQTPRAAELAEFVKRQSDWLPDYAQFRAFKDGFGGVAWWDWPAEIRERRPEALDR
LRQERARDILYYEYVQWLAHAQWEAARADLREKGVEIMGDLPFMVSRDSADVWAHQDEFR
HDMSVGAPPDQFDTEGQNWGLPPYYWARMRENGFAWLRRRCRYTGLLCDRFRIDHLVGFY
RTYIFPERKSQGQGGERPRATFDPAEEPEQREHGERVVRAMIEGAAETGAQLVAEDLGAV
PPWVRASLTALGVPGYKVLIWEKDDVVFRNPAEYPPLSVACFGTHDTDSVVAWWESRDDR
ERAGVLDLPQLAPRRHEFGREFTKETHRALLDLIHGSKSELVLLLVQDVLATRDRVNTPG
TVGPENWSLRLPAPPAAMDRDPEVRGALERVRVSIEASGRG
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
gtgacggtgccgctcttctcgctccgcagcgatcgctcgtggggcatcggcgagatcgga
gatctccccgagttcgccgcgtggatgcgcggcgcggggctccgcctcgtgcagctcctg
ccgctcggcgaggtgtcgggcggcgagacgtcgccgtacatggcgctctccgcgttcggc
atcgacccgatgtacatctcgctctcggccgtgcccgagctcccgccggagctccacggc
gaggcgctcggcgacgacgcggcggcgctcgatcgcgcgaagcagagcgcgcgcgtcgac
tacgatctcgtgcgccgcgtgaaggggcgggcgctgcgcttcgccttcgaccggttcgag
cgggagcaccacgcgaagcagacgccgcgcgcggccgagctggccgagttcgtgaagcgg
cagtcggactggctgcccgactacgcgcagttccgcgcgttcaaggacggcttcggcggc
gtcgcgtggtgggactggcccgcggagatccgcgagcggaggccggaggcgctcgacagg
ctgcggcaggagcgcgcgcgggacatcctctactacgagtacgtccagtggctcgcgcac
gcgcagtgggaggcggcgcgcgcggatctccgggagaagggggtcgagatcatgggcgac
ctcccgttcatggtgtcgcgcgacagcgccgacgtgtgggcgcaccaggacgagttccgg
cacgacatgtcggtcggcgccccgcccgatcagttcgacacggaggggcagaactggggg
ctcccgccgtactactgggcccggatgcgcgagaacggcttcgcgtggctgaggcggcgc
tgccgctacacggggctgctctgcgaccggttccggatcgatcacctggtcggcttctac
cggacgtacatcttcccggagcgcaagagccaggggcaggggggcgagcggcccagggcg
acgttcgatccggcggaggagccggagcagcgcgagcacggcgagcgcgtggtgcgggcg
atgatcgagggggcggcggagaccggggcgcagctcgtggccgaggatctcggcgcggtg
ccgccgtgggtgcgggcgtcgctgacggcgctcggggtgccggggtacaaggtgctgatc
tgggagaaggacgacgtggtgttccgcaatccggcggaatacccgccgctctcggtcgcg
tgcttcgggacgcacgacaccgactcggtggtggcgtggtgggagtcgcgggacgaccgg
gagcgcgcgggggtgctcgatctgccgcagctcgcgccgcggcggcacgagttcgggcgg
gagttcacgaaggagacgcaccgggcgctgctcgacctgatccacgggtcgaagagcgag
ctcgtgctgctgctcgtgcaggacgtgctcgcgacgcgggatcgggtcaacacgccgggg
accgtggggccggagaactggtcgctgcggctgccggcgccgccggcggcgatggaccgg
gatcccgaggtgcggggggcgctcgagcgggtgcgggtgagcatcgaggcgagcgggcgc
gggtga

DBGET integrated database retrieval system