KEGG   Sorangium cellulosum So0157-2: SCE1572_22085Help
Entry
SCE1572_22085     CDS       T02718                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
scu  Sorangium cellulosum So0157-2
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:scu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SCE1572_22085
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    SCE1572_22085
Enzymes [BR:scu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     SCE1572_22085
Lipid biosynthesis proteins [BR:scu01004]
 Desaturase
  First
   SCE1572_22085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6252019..6252807
Genome map
AA seq 262 aa AA seqDB search
MYKPRMELVIFLIAHSTLAVFFQTFFLHRYASHRMFTMSRRSERVFHFLTYLTQGSSYLV
PWAYAILHRMHHAYSDTPKDPHSPRHSAGPASMMWRTKKLYDAICDGTADVEPRFLGGYP
EWRTLDRIGNSWFSRISWGAGYAVVYVAFASHWWQFLFVPLHWTLGPLHGAIVNWCGHRY
GYRNFDSDDDSRNTLALDFVTLGELFQNNHHKYSMSSNFAVRRFEIDPAYQVIRVFAWLG
ILQMPDKRQMARLGPGAARAEG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
gtgtacaagccgcgcatggagctcgttattttcctcatcgcccactccacactcgcggtc
ttcttccagaccttcttcctgcaccggtacgcctcgcatcggatgttcacgatgtcgagg
cgctccgagcgagtttttcacttcctgacgtacctcacgcaaggctcgtcgtatctcgtc
ccctgggcctacgccatcttgcaccgcatgcaccacgcgtacagcgacacgcccaaggac
ccgcactcgccgcggcactctgcagggcccgcctcgatgatgtggcggaccaagaagctc
tacgacgccatctgcgacggcaccgccgacgtggagccgcgcttcctcggcggctacccc
gagtggcgcacgctcgaccgcatcggcaactcgtggttcagccgcatctcgtggggcgcg
ggctacgccgtggtctatgtcgccttcgcctcgcactggtggcagttcctgttcgtcccg
ctgcactggaccctgggtccgctgcacggagcgatcgtgaactggtgcggccaccgctac
ggctaccgcaacttcgacagcgacgacgactcgcgcaacacgctggcgctcgacttcgtg
acgctgggcgagctcttccagaacaaccaccacaagtactcgatgagctccaacttcgcg
gtgcggcggttcgagatcgacccggcctatcaggtcatccgcgtgttcgcgtggctgggc
atcctccagatgcccgacaagcgtcagatggcccggctggggcccggcgccgctcgggcc
gaggggtag

DBGET integrated database retrieval system