KEGG   Sorangium cellulosum So0157-2: SCE1572_28110Help
Entry
SCE1572_28110     CDS       T02718                                 

Definition
hypothetical protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
scu  Sorangium cellulosum So0157-2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SCE1572_28110
Enzymes [BR:scu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     SCE1572_28110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8044680..8046086)
Genome map
AA seq 468 aa AA seqDB search
MVTGAGLRLGLCVAAAQAAALAGCVAPSDTGEGEAIEGELTDEQSYAASTRPVDVHGRLQ
IVGKELRNQNNAPVQLKGMSLFWSQWGGSFYNANVVNSIADSWGATVVRAAMGVESGGYL
TNPTAEKNRVKTVVDAAIARGIYVIIDWHDHSAQDHKEQAKAFFREMAQTYGNQPNVLFE
IYNEPDNEPWSTIKPYAIEVINTIRSAGSNNVIIVGTPTWSQDVDIAANDPITGFSNIAY
TLHFYANTHKESLRAKARTAMDRGLALFVTEFGTCDASGNTGLNLNESQTWIDFLNANKI
SWANWSLFDKNETASALTPGARTTGSWPDSELTQSGKWVKARMLEGTGGSGGGSSSSTSS
SSSSSGTGGSGGGGGAGGSGGGTTTSGFQFTVSPNVNRWWIQVKVVEPGYRITGVTARVN
STTHKLDPQSWGEGEYAISREVPAGTRVVFTATDSRGATASFTSNPWP
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggtgacgggggcgggcctccggctcgggctgtgcgtcgcggcggcgcaggcggccgcg
ctcgcgggctgcgtggcgccgtcggacacgggcgaaggcgaggcgatcgagggcgagctc
acggacgagcagtcgtatgcggcctccacgaggccggtggacgtgcacggcaggctccag
atcgtgggcaaggagctccggaaccagaacaacgcgccggtccagctgaagggcatgagc
ctgttctggagccagtggggcggatcgttctacaacgcgaacgtcgtcaactcgatcgcc
gacagctggggggcgaccgtggtccgcgccgcgatgggcgtcgagtcgggcgggtacctc
acgaacccgacggccgagaagaaccgggtgaagaccgtcgtcgacgcggcgatcgcccgg
ggcatctacgtgatcatcgactggcacgatcacagcgcccaggaccacaaggagcaggcc
aaggccttcttccgggagatggcgcagacctacgggaaccagcccaacgtcctcttcgag
atctacaacgagccggacaacgagccctggagcacgatcaagccctatgcgatcgaggtg
atcaacacgatccgcagcgcgggctcgaacaacgtgatcatcgtcggcacgccgacctgg
tcgcaggacgtggacatcgccgcgaacgacccgatcaccgggttctcgaacatcgcttac
acgctccacttctacgccaacacgcacaaggagagcctgcgcgccaaggcgaggacggcc
atggacaggggccttgccctgttcgtgaccgagttcggcacctgcgacgcctccgggaac
accgggctcaacctcaacgagtcccagacctggatcgacttcctgaacgccaacaagatc
agctgggccaactggtcgctgttcgacaagaacgagacggcctcggcgctcacccccggc
gccaggaccaccggcagctggccggactcggagctcacccagtcgggcaagtgggtcaag
gcgaggatgctggaaggcaccggcggctcgggcggcggaagcagcagcagcacgagcagc
agcagcagcagcagcgggaccggcggctcgggcggcggaggcggcgcgggcggctccggc
ggcggcaccacgacctcggggttccagttcaccgtgtccccgaacgtcaaccggtggtgg
atccaggtgaaggtcgtcgagccggggtaccgcatcaccggcgtcacggcgcgcgtgaac
agcaccacgcacaagctcgatccccagtcctggggcgagggcgagtacgccatcagccgg
gaggtccccgcgggcacgcgggtcgtcttcacggccacggacagccgcggcgccaccgcg
agcttcacgtcgaacccctggccgtga

DBGET integrated database retrieval system