KEGG   Sorangium cellulosum So0157-2: SCE1572_33180Help
Entry
SCE1572_33180     CDS       T02718                                 

Definition
hypothetical protein
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
scu  Sorangium cellulosum So0157-2
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scu00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SCE1572_33180
  Amino acid metabolism
   00380 Tryptophan metabolism
    SCE1572_33180
Enzymes [BR:scu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     SCE1572_33180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9456316..9458490)
Genome map
AA seq 724 aa AA seqDB search
MAEQGEKGAGPEISAHSKIDSLEPHREDLAGTVLSTDQGIRIDSTDDSLKAGARGPALLE
DFHLREKITHFDHERIPERVVHARGSGAHGYFQVYASMAEVTRAAFLQDPSVRTPVFVRF
STVVGSRGSADTVRDVRGFATKFYTKEGNFDLVGNNIPVFFIQDGIKFPDVIHAVKPEPD
REIPQASSAHDTFWDFISLMPESTHMAMWVLSDRAIPRSFRMMEGFGVHTFRLVNAQGKS
RFVKFHWKPLLGVHAHVWDEAQELAGRDPDYHRRDLWDAIERGDYPEYELGVQIIEEEDE
FAFDFDLLDATKIVPEELVPVRRIGKLTLNRNPDNFFAETEQVAFHTANIVPGIDFTDDP
LLHVRNFSYLDTQLLRLGGPNFPQIPINRPLAPVHNQNRDGFMQQRIKQGRAHYVPNSLA
GGCPVTASWETGAFVHYAERVLGLKQRVRSDSFKDHITQARLFWNSLSVPEKKHLIRAAR
FELGNVASRDVRERMVARLGEVDTELGRQVAEAIGVAPPAGQPQVPSKGGKAAGKRSVDA
SPALSMENTVKDTVKSRLVALLVADGFVVAELAAVKAALEAAGAHAQVVSTRLGPILGDD
GSAVEADRSLLTAKSVMFDAVYVPGGRASVAALAASGEAVHFVNEAFKHCKAIGATGDAV
DLLVATDIQGVALADVQTGAPPLSDKGVVTLRDPAALALFTQELLRAIAQHRHWDREDIA
QIPA
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcaaggcgagaagggcgcgggcccggagatcagcgcgcacagcaagatcgat
agcctggagcctcaccgagaggacctggcgggcacggtgctctcgaccgaccagggcatc
cggatcgacagcaccgacgattcactcaaggccggggccagggggccggcgctccttgaa
gacttccatctacgcgaaaagattacgcatttcgatcacgagcgcatccccgagcgcgtc
gtgcacgcgcgcggctccggggcgcacggctacttccaggtctacgcctcgatggccgag
gtcacgagggcggcgttcctgcaggacccgagcgtcaggacgccggtcttcgtgcggttc
tccacggtggtcggctcgcgcgggtcggcggacacggtccgcgacgtgcgcggcttcgcg
acgaagttctacacgaaggaggggaatttcgacctcgtcggcaacaatatcccggtcttc
ttcattcaggacggcatcaagtttccggatgtgatccacgcggtcaagccggagccggac
cgggagatcccgcaggcctcgtccgcgcacgacacgttctgggacttcatctcgctcatg
ccggagtcgacccacatggccatgtgggtgctctcggatcgcgccatcccgcggagcttc
cgcatgatggagggcttcggcgtccacaccttccgcctcgtcaacgcgcagggcaaatcg
cgcttcgtcaagttccactggaagccgctcctcggcgtgcacgcccatgtctgggacgag
gcgcaggagctcgccggcagggatccggactaccaccgccgcgacctctgggacgccatc
gagcggggggattaccccgagtacgagctcggcgtgcagatcatcgaggaagaggacgag
ttcgccttcgacttcgatctgctcgacgcgacgaagatcgtccccgaggagctcgtgccg
gtgcgccgcatcggcaagctgaccttgaaccgcaacccggacaacttcttcgccgagacc
gagcaggtcgcgttccacacggccaacatcgtgcccgggatcgacttcaccgacgatcct
ctgctccacgtccggaacttctcgtacctcgacacgcagctcctgcggctcggcggcccg
aacttcccgcagatccccatcaatcgtccgctggccccggtgcacaaccagaaccgggac
ggcttcatgcagcagcggatcaagcagggtcgggcgcactacgtcccgaactcgctcgcc
ggcggctgtccggtgacggcgtcctgggagacgggcgccttcgtgcattacgccgagcgg
gtgctcgggctcaagcagcgcgtgcggagcgacagcttcaaggatcacatcacccaggcg
aggctcttctggaacagcctctcggtgcccgagaagaagcacctcatccgcgcggcgcgc
ttcgagctcggcaacgtggcgagccgggacgtccgcgagcgcatggtcgcgcggctcggc
gaggtcgacaccgagctcggccggcaggtggccgaggcgatcggcgtcgccccgcccgcg
ggccagccgcaggtgccttcgaagggcggcaaggccgcgggcaagcgctcggtggacgcc
tcgccggcgctcagcatggagaacacggtgaaggacacggtgaagagccggctcgtcgcg
ctgctcgtggccgacgggttcgtcgtcgccgagctcgcggcggtgaaggcggcgctcgag
gcggccggcgcgcacgcgcaggtcgtgtcgacgcggctcgggccgatcctcggcgacgac
ggcagcgccgtggaggcggacaggtcgctgctcacggcgaagtcggtcatgttcgatgcg
gtctatgtccccggcgggcgcgccagcgtcgcggcgctcgcggcctcgggggaggcggtg
catttcgtcaacgaggcgttcaagcactgcaaggcgatcggggcgacgggcgatgcggtc
gatctcctcgtggcgacggacatccagggcgtcgcgctggccgacgtgcagaccggggcg
ccgcccctgtccgacaagggcgtggtgaccctgcgcgaccccgcggcgctcgccctgttc
acccaggagctcctccgcgccatcgcgcagcaccgccactgggaccgcgaggacatcgcg
cagatccccgcctga

DBGET integrated database retrieval system