KEGG   Sorangium cellulosum So0157-2: SCE1572_33710Help
Entry
SCE1572_33710     CDS       T02718                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
scu  Sorangium cellulosum So0157-2
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:scu00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9590663..9591790)
Genome map
AA seq 375 aa AA seqDB search
MAERAARGAAAWYTGAMRRVAIVGGGLAGCIVAFRRAAAGDRVTLVEAAPRLGGQLWTER
TAGFVVEHGAEGFIARSEAVPALAGALGIAGDLVGQETHRSFGFDGAALRELAPGEAAAF
LGFQVPRDELGKGIRTFRHGMEQLTETLARALASDERAEVRTSAAAASLARAAGGGFRLA
LAGGAEVDADAVVIATHAAGAAALLGEPARALRDAETLSSVTVSLAYPRAAIEHPLDGTG
FVVAAGHQAHGFRACTFTTSKFVERAPAGHVALRLFFRPEPADLERMGDDAWAARAEASL
ARVLRVRGPAERAWVSRWSSALPVSTPAHAARVRETERALAGSGVLLAGSAFHGSGIDAA
VRSAEAAAERVGALP
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
gtggccgagcgcgccgctcggggcgccgccgcgtggtatacgggtgcgatgcgacgcgtc
gccatcgtcggaggcggtctggccgggtgcatcgtcgcgttcaggcgggcggcggcgggc
gatcgggtgacgctcgtcgaggcggcgccgcggctgggcgggcagctctggaccgagcgg
accgccgggttcgtggtggagcacggcgccgaggggttcatcgcgcggagcgaggccgtg
cccgcgctggcgggcgcgctcggcatcgccggcgatctcgtcggccaggagacgcacagg
tcgttcggcttcgacggcgccgcgctgcgggagctcgcgcccggcgaggcggcggcgttc
ctcggcttccaggtgccgcgcgacgagctcggcaaggggatccggaccttccgccacggg
atggagcagctgaccgagacgctcgcgcgcgcgctcgcgagcgacgagcgcgccgaggtg
cgcacctccgccgcggccgcctcgctcgcgcgggcggccggcggcggcttccggctcgcg
ctcgccggcggggccgaggtcgacgccgacgcggtggtgatcgccacccacgccgccggc
gcggccgcgctgctcggcgagccggcgcgggcgctccgcgacgccgagacgctctccagc
gtgaccgtctcgctcgcctacccgcgcgccgcgatcgagcacccgctcgacggcaccggc
ttcgtggtcgccgcggggcaccaggcgcacggcttccgcgcgtgcacgttcacgacctcg
aagttcgtcgagcgcgctcccgccggccatgtcgcgctgcgcctcttcttccgccccgag
ccggcggacctcgagcggatgggcgacgacgcgtgggcggcgcgcgccgaggcctcgctc
gcgcgcgtgctgcgcgtgcgcgggcccgccgagcgcgcctgggtctcgcgctggtcgagc
gcgctcccggtctccacgcccgcgcatgcggcgcgggtgcgggagaccgagcgagcgctc
gccggcagcggcgtgctcctcgccggctcggcgttccacggctccgggatcgacgcggcc
gtgcgctccgccgaggcggccgcggagcgcgtcggcgccctgccgtga

DBGET integrated database retrieval system