KEGG   Sorangium cellulosum So0157-2: SCE1572_35045Help
Entry
SCE1572_35045     CDS       T02718                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
scu  Sorangium cellulosum So0157-2
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:scu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SCE1572_35045
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SCE1572_35045
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SCE1572_35045
Enzymes [BR:scu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SCE1572_35045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9954838..9957096
Genome map
AA seq 752 aa AA seqDB search
MTAGAVVVPTACSEDEGVAGACDAHENDAYFPQSVASGDPRPDSVVLWTRLVDSQQTADV
SLALVIALDEGFTQLVTLTPTSSSAATVGSTSTRLSVIARADFDHCVKVKVSGLSPGTTY
YYRFYYTTGNGCVSSRVGRTRTAPTPDADVPVRFAFVSCQDYVGRYYNAYAALAREQLDF
VVHLGDYIYETTGDPSIQTPSEERKVTFSDVNGAIAFEPAEGAPYYAARSLSNYRELYKT
YRSDRALQRVHELFPMIAIWGDHEFSRECYGATATYFDGRQPETDVERRKAANQAWFEYM
PVDYPAGDDFTYDRTADYPQDMTIYRDFTFGKHVHLVMTDLRTYRADHLIPEDGFPGKVI
ARQGELVAQLGSLPEHAGNYIEDIDNHEQGLYATALEEAAPLLGFDPSLGFAQDESPRTV
SASFVNAVVAKLNEQRSVEEQLPLITRMESAGMDFGIAYVDLGKYVDFTLEKPDFYSAFG
SRYFVVKETFDAASRFAYDPSTGSDTMVMGEAQLAWFKDTIKESKSTWKVWGNEYCLSQL
AIDLTPSFAEDDPLKRRFYLSCDGWDGFREQRNALLSEIATAGNVVAITGDLGAFLAGTP
AVDRADAEPAKIVEFVGAAISSATYQSRLQRQIASHPLLKHAMGAESIAVGIDDYLVEKG
VAAPANPYLAFSNASSNGFCIAEANADEFVVSMHMLPADALAKPLYEEADAATLDGQITI
ARYKTVAGESDLYEEEGGTWKKWSPATASEGG
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgccggcgcggtggtcgtgcccacggcctgctccgaggacgagggggtggccggc
gcgtgcgacgcgcacgagaacgacgcgtactttccccagtcggtggcctccggagacccg
aggcccgacagcgtcgtgctgtggacccggctcgtcgacagccagcagacagcggatgtc
agcctggcgctcgtcatcgcgctcgacgaggggttcacgcagctcgtgacgctcacgccg
acgtccagcagcgcggccaccgtgggatcgaccagcacgcggctctcggtgatcgcccgg
gcggacttcgatcactgcgtcaaggtcaaggtgagcggcctgagccccgggacgacctac
tattaccgcttctactacacgacgggaaacggctgtgtcagctcgcgtgtcgggcggacg
cggacggcgccgacgcccgacgcggacgtgccggtgcgcttcgccttcgtgtcgtgtcag
gactacgtcggtcgctactacaacgcctacgcggccctggcgagagagcagctcgacttc
gtcgtccacctcggggactacatctacgagacgaccggcgatccgagcatccagaccccc
tcggaggagcgcaaggtcaccttctccgacgtgaacggcgcgatcgccttcgagccggca
gagggcgccccgtactacgccgcccggtcgctgagcaactaccgggagctctacaagacg
taccggtccgaccgggcgctccagcgggtgcacgagctgtttcccatgatcgccatctgg
ggcgatcacgagttctcccgcgagtgctacggcgcgaccgcgacctatttcgacggccgg
cagccggagacggacgtcgagcggcgcaaggcggcaaaccaggcgtggttcgagtacatg
cctgtcgattacccggcgggcgacgacttcacctacgacaggacggccgactacccccag
gacatgaccatctaccgggacttcaccttcgggaagcacgtccacctcgtgatgacggat
ctccgcacctaccgcgcggatcacctgatcccggaggacggcttcccggggaaggtcatc
gcgaggcagggggagctcgtggctcagctcgggagcttgcccgagcacgcgggcaactac
atcgaggacatcgataaccacgagcaaggcctgtacgcgacggcgctggaggaggccgcg
cccctgctcggcttcgatccgagcctcgggttcgcgcaggacgagtcgccccgcaccgtc
agcgcctccttcgtcaacgcggtcgtggcgaagctgaacgagcagcggtcagtagaagag
cagctgcccctcatcaccagaatggaatccgctggaatggatttcgggatcgcctacgtc
gatctcgggaagtacgtcgacttcacgctcgagaagcctgatttttacagtgcgttcggg
tcgcgttatttcgtggtcaaggagacgttcgatgcggcctcgcggttcgcgtacgatccg
tccacggggagcgacaccatggtcatgggggaggcgcagctggcctggttcaaggacacg
atcaaggagtccaagagcacgtggaaggtgtggggcaacgaatactgcctctcgcagctc
gccatcgatctcacgccgtccttcgcggaggacgacccgctcaagcggcgcttctacctg
agctgcgacggctgggacggcttccgcgagcagcggaacgcgctgctcagcgagatcgcg
acggccggcaacgtggtggcgatcaccggcgatctcggcgccttcctcgcagggacgccg
gcggtggaccgcgccgacgccgagccggcgaagatcgtggagttcgtcggcgccgcgatc
tcgtcggccacgtaccagtcgcggctgcagaggcagatcgccagccatccgctgctgaag
cacgccatgggcgcggagagcatcgccgtcggcatcgacgactacctcgtcgagaagggc
gtcgccgccccggccaatccttacctcgccttcagcaacgccagcagcaacgggttctgc
atcgccgaggcgaacgccgacgagttcgtcgtgagcatgcacatgctccccgcagacgcg
ctcgcgaagccgctgtacgaggaggccgacgcggcgacgctcgacggtcagatcacgatc
gcgcggtacaagacggtcgcgggtgaatcggacctgtacgaggaagaagggggcacctgg
aagaagtggagcccggccacggcgagcgagggcggctga

DBGET integrated database retrieval system