KEGG   Sorangium cellulosum So0157-2: SCE1572_36100Help
Entry
SCE1572_36100     CDS       T02718                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
scu  Sorangium cellulosum So0157-2
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:scu01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:scu01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(10233535..10234308)
Genome map
AA seq 257 aa AA seqDB search
MEIAIVLIAHSTLSVFFQTFFLHRYASHRMFTMSKRWERTFHFLTYLTQGSSYLVPWVYA
ILHRMHHAYSDTPKDPHSPRYYSSVVPMMLDTAKRYDAIYDGTADVEPRFRGGYPEWRTL
DRIGNSWISRLAWGTGYVVFYAAFASHWWQFLFLPLHWTMGPLHGAIVNWCGHRYGYRNF
NSDDDSRNTLALDLVTLGELFQNNHHKYAMSPNFAVRWFEIDPAYQVIRVLAWLGILQMS
DKRQVARLEPEVARAEG
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggagatcgcgatcgtcctcatcgcccactctacgctttcggtctttttccagaccttc
ttcctgcaccggtacgcctcgcaccggatgttcacgatgtcgaagcggtgggagcggact
tttcacttcctgacgtacctgacgcagggctcttcgtacctggttccgtgggtttacgcg
atcttgcaccgcatgcaccacgcgtacagcgacacgccgaaggacccgcactcgccgcgg
tactactccagcgtcgtcccgatgatgctcgacacggcgaagcgctacgacgccatctac
gacggcacggccgacgtggagccgcgcttccgcggcggctaccccgagtggcgcacgctc
gatcgcatcggcaactcgtggatcagccggctcgcgtggggcacgggctacgtggtcttc
tacgcggccttcgcctcgcactggtggcagttcctgttcctcccgctccactggaccatg
ggcccgctgcacggggcgatcgtgaactggtgcggccaccgctacggctaccgcaacttc
aacagcgacgacgactcccgcaacacgctggccctcgacctcgtgacgctcggcgagctc
ttccagaacaaccaccacaagtacgcgatgagcccgaacttcgcggtgcggtggttcgag
atcgacccggcctaccaggtcatccgcgtgctcgcctggctgggcatcctccagatgtcc
gacaagcgccaggtcgcccggctggagcccgaggtcgcgcgggccgaagggtag

DBGET integrated database retrieval system