KEGG   Sorangium cellulosum So0157-2: SCE1572_36100Help
Entry
SCE1572_36100     CDS       T02718                                 

Definition
(GenBank) fatty acid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
scu  Sorangium cellulosum So0157-2
Pathway
scu01040  Biosynthesis of unsaturated fatty acids
scu01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:scu00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    SCE1572_36100
Enzymes [BR:scu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     SCE1572_36100
Lipid biosynthesis proteins [BR:scu01004]
 Desaturase
  First
   SCE1572_36100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-ProteinID: AGP32725
UniProt: S4XLR6
Position
complement(10233535..10234308)
Genome map
AA seq 257 aa AA seqDB search
MEIAIVLIAHSTLSVFFQTFFLHRYASHRMFTMSKRWERTFHFLTYLTQGSSYLVPWVYA
ILHRMHHAYSDTPKDPHSPRYYSSVVPMMLDTAKRYDAIYDGTADVEPRFRGGYPEWRTL
DRIGNSWISRLAWGTGYVVFYAAFASHWWQFLFLPLHWTMGPLHGAIVNWCGHRYGYRNF
NSDDDSRNTLALDLVTLGELFQNNHHKYAMSPNFAVRWFEIDPAYQVIRVLAWLGILQMS
DKRQVARLEPEVARAEG
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggagatcgcgatcgtcctcatcgcccactctacgctttcggtctttttccagaccttc
ttcctgcaccggtacgcctcgcaccggatgttcacgatgtcgaagcggtgggagcggact
tttcacttcctgacgtacctgacgcagggctcttcgtacctggttccgtgggtttacgcg
atcttgcaccgcatgcaccacgcgtacagcgacacgccgaaggacccgcactcgccgcgg
tactactccagcgtcgtcccgatgatgctcgacacggcgaagcgctacgacgccatctac
gacggcacggccgacgtggagccgcgcttccgcggcggctaccccgagtggcgcacgctc
gatcgcatcggcaactcgtggatcagccggctcgcgtggggcacgggctacgtggtcttc
tacgcggccttcgcctcgcactggtggcagttcctgttcctcccgctccactggaccatg
ggcccgctgcacggggcgatcgtgaactggtgcggccaccgctacggctaccgcaacttc
aacagcgacgacgactcccgcaacacgctggccctcgacctcgtgacgctcggcgagctc
ttccagaacaaccaccacaagtacgcgatgagcccgaacttcgcggtgcggtggttcgag
atcgacccggcctaccaggtcatccgcgtgctcgcctggctgggcatcctccagatgtcc
gacaagcgccaggtcgcccggctggagcccgaggtcgcgcgggccgaagggtag

DBGET integrated database retrieval system