KEGG   Sorangium cellulosum So0157-2: SCE1572_39610Help
Entry
SCE1572_39610     CDS       T02718                                 

Definition
hypothetical protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
scu  Sorangium cellulosum So0157-2
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SCE1572_39610
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SCE1572_39610
Enzymes [BR:scu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     SCE1572_39610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11180898..11182487
Genome map
AA seq 529 aa AA seqDB search
MLAFFFMACGPSTSATEPEGSGGSGSGAGGPGSVAGSSTSTGGSTGSGGTDASASTGSGG
AGGEPPGDGGAGGSSTGGGPPVVEPTLITSGPNDYWKTGTPTEVTSGNADVTVDEATTHQ
RWDGFGGTFNEVGWNVLSMLGEAERARAIELLFDKHEGAAFAYGRIPIGASDYAMDRYTL
DETPNDTAMASFSIDRDKERLIPYIKAALVVRPGLHLWASPWTPPTWMKSNGAFDGGRMK
DDASTLQAYALYLAKFVEAYAGEGITIEAVHPQNEPNYETRYPSCTWTGALMAKFIGTYL
GPTFADRGLTAQIYLGTMSNNESGKDGAIISAVTGDATAMGYVKGFGLQWNMMSSASGLR
SRNLPIVQTEHKCGNYPWNPTGSPPFDAQKAPNDHAYAEESWGLIRDWIKAGVTSYSAWN
MVLDTAGKNLDSERPWPQNALLTVDTAAKTLNVTPVYHVFRHVSEYVDPGATRVATTGGD
ALAFKNPDGSIVTILYNSGNAAKMTVLDVAGKKLQFSVPAHGWATVNWT
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
ttgctggcatttttcttcatggcttgcggtccttcgaccagcgcgacggagcccgagggc
tcgggcggctcggggtcgggggcgggcggcccggggtcggtggcggggagctcgacgagc
acgggcggctcgaccgggtcggggggaacagacgcgagcgcctcgaccgggtcggggggc
gccggcggcgagccgcccggagacggcggcgctggcggctcgtccaccggcggcgggccc
cccgtcgtcgagcccacgttgatcacgtccggtccgaacgattactggaagacaggaacg
ccgacggaggtgacgagcggcaatgccgatgtgaccgtcgacgaggcgacgacgcaccag
cgatgggacgggttcggcggcaccttcaacgaggtgggctggaacgtcctctcgatgctc
ggcgaggcggagagggcgcgagccattgagctcctcttcgacaagcacgagggcgcggcg
ttcgcctacgggcgcatcccgatcggggccagcgactacgcgatggaccgctacaccctc
gacgagacgccgaacgacaccgcgatggcgagcttctccatcgatcgggacaaggagagg
ctgattccgtacatcaaggcggcgctcgtcgtgaggcccggcctccacctctgggccagc
ccctggacgccgcccacctggatgaagagcaacggcgccttcgacggcggccgcatgaag
gacgacgcgagcaccttgcaggcgtatgccctgtacctcgcgaagttcgtggaggcgtac
gccggagagggcatcaccatcgaggcggttcacccccagaacgagccgaactacgagacg
aggtacccgagctgcacctggacgggggcgctcatggccaagttcatcggcacgtatctg
gggccgacgttcgccgaccgggggctcacggcgcagatctatctcggcacgatgtccaac
aacgaaagcgggaaagacggggcgatcatcagcgccgtgaccggcgacgccaccgcgatg
gggtacgtcaagggattcgggctgcagtggaacatgatgagcagcgcgtccggcttgaga
tcgcgcaatctgccgatcgtgcagacggagcacaagtgcggcaactacccctggaacccc
acgggctcaccgccgttcgacgcgcagaaggcgccgaacgatcacgcgtacgccgaggag
agctgggggctcatccgcgactggatcaaggcaggggtgacctcgtacagcgcctggaac
atggtgctggacacggcggggaagaacctggactcagagcggccgtggccccagaacgcg
ctgctcaccgtggacacggcggcgaagacgctgaacgtgacccccgtctaccacgtcttc
cgccatgtctccgagtacgtcgatcccggggcgacgcgcgtcgccacgaccggcggcgat
gcgctggccttcaagaaccccgacgggagcatcgtcacgatcctgtacaactccggcaat
gcggcgaagatgaccgtcctcgatgtggccgggaagaagctccagttcagcgtccctgcc
cacgggtgggcgaccgtcaactggacgtga

DBGET integrated database retrieval system