KEGG   Sorangium cellulosum So0157-2: SCE1572_44555Help
Entry
SCE1572_44555     CDS       T02718                                 

Definition
hypothetical protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
scu  Sorangium cellulosum So0157-2
Brite
Enzymes [BR:scu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     SCE1572_44555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12539650..12540360
Genome map
AA seq 236 aa AA seqDB search
MNNITRLGMCSALGLLLTSCVIEGAEADMTEAELAADQSALAINTNQTGTDGRWYTFWKD
GGSVSMNLNGGGNYAVNWANGNYNFVGGKGWSTGSSSRNIGYNAGVWSTGSSNAYLTLYG
WTTNPLVEYYVVDSWGSWRPPGGASAGTVTTDGGTYDLYRMQRVNAPSIIGNATFYQYWS
VRRSKRATGTNSAITFSNHVNAWASKGWHLGTHNYQVMATEVFNPSSSGSSNLTVW
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacatcacccggctcggcatgtgctccgcccttgggctcctactgaccagctgc
gtcatagaaggcgcagaagcggacatgaccgaggccgaacttgccgccgatcaaagcgcc
ctcgcgataaacacgaatcaaaccggcacggacggccggtggtacacgttctggaaagac
ggcgggtcggtcagcatgaatttgaacggcggcggcaactacgctgtcaattgggcgaac
ggcaactataatttcgtcggcggcaagggctggagcactgggtcgtcgagcaggaacatt
ggctacaatgccggcgtctggtcgacgggcagcagcaacgcatatctgactctctatgga
tggacgacaaacccactcgtagaatactacgtcgttgacagctggggcagctggagaccg
ccgggcggagcgtcggcgggcacagtcaccacggacgggggcacctacgacctatacagg
atgcagcgagtcaacgcgccatccatcataggcaatgcgacgttctatcagtactggagt
gtccgaaggtcgaagagggccaccgggaccaacagcgccatcacgttttccaatcacgta
aatgcttgggcgtcgaaggggtggcaccttggcactcacaattaccaggtgatggcgaca
gaggtgttcaacccctcgagcagcggcagctccaacttgacggtgtggtag

DBGET integrated database retrieval system