KEGG   Sorangium cellulosum So0157-2: SCE1572_45500Help
Entry
SCE1572_45500     CDS       T02718                                 

Definition
hypothetical protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
scu  Sorangium cellulosum So0157-2
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:scu03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(12811057..12811923)
Genome map
AA seq 288 aa AA seqDB search
MPELPEVEHAAASLRLFLAGDRIASAEGDRTRLFRGSSRDAFERDLPGRALERLTRFGKY
LALELDAGVVLLSHLGMTGKWVRRSAGEPAPAHSRARLLLASGSVLHYSDPRLLGRLAVL
RGVSPGEIPEIAALGPDPLRDGIDVDALARRARASARAVKAILMDQAVIAGLGNIQATEA
LFRAGVHPARPGRSLSREEVAAIAAGALGSIAHTLRAIGGGEIAYLSESGATPNPFLVYA
RAGEPCPRCGAALETRAIGGRSSAFCPRCQPERGRARARAGPRRAPRR
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
gtgccggagctccccgaggtcgagcacgccgccgcctcgctgcgcctcttcctggcgggc
gaccggatcgcgtccgccgagggcgaccgcacccgcctgttccgcggatcgagccgcgac
gctttcgagcgcgatctcccgggccgcgcgctcgagcgcctcacgcgcttcggcaagtac
ctcgcgctcgagctcgacgccggcgtggtgctgctcagccacctcgggatgaccggcaaa
tgggtgcgccgctcggcgggcgagcccgcgccggcgcacagccgcgcccggctgctgctc
gcttcggggagcgtgctccactacagcgatccgcggctcctcggccgcctcgcggtgctg
cgcggcgtctcgccgggcgagatccccgagatcgccgcgctgggcccggatccgctgcgc
gacgggatcgacgtggacgccctggcgcggcgcgcgcgggcgagcgcgcgcgccgtgaag
gcgatcctcatggaccaggcggtgatcgccggcctcggcaacatccaggcgaccgaggcg
ctcttccgggccggcgtgcacccggcgcggccgggccgatccctctcgcgcgaggaggtg
gccgcgatcgccgccggcgccctgggctcgatcgcgcacacgctccgggcgatcggcggc
ggggagatcgcctacctgtccgagtccggcgcgacgccgaacccgttccttgtctacgcg
cgcgccggcgagccgtgcccccgctgcggcgcggcgctggagacgcgcgcgatcggcggt
cgctccagcgccttctgcccgcgctgccagccggagcgcggccgcgcgcgggcgcgagct
gggccgcgcagggcgccccggcgctga

DBGET integrated database retrieval system