KEGG   Sorangium cellulosum So0157-2: SCE1572_48560Help
Entry
SCE1572_48560     CDS       T02718                                 

Definition
hypothetical protein
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
scu  Sorangium cellulosum So0157-2
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:scu01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:scu00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(13632919..13634076)
Genome map
AA seq 385 aa AA seqDB search
MTDHEERTAAKGAAGRHAEGPAPELDPDGARAALKRCRRIIVKIGSKSLSGDAWDRLAVE
VAALRARSGRNLVIVSSGAIALGVTKLGLKARPKDMAWLQAAAAAGQSVLMQRYEEAFGK
VGLRVAQVLLTHADLADRTRTNNARNALAALLEAGAIPIINENDAVAVEEIKFGDNDQLA
AMVTPLCEADLLILLSDVEGLLDGDGRRVPFVRSVAREARHLAGGSTSGVGTGGMASKVE
AARRATLAGSHVVIAAAREPGIITSILSGEDVGTLFAAVPQRLSARKHWIAYTLRPRGAI
LVDRGAAEAIASKNRSILAVGVLGVRGTFLPGDAVAVFDPEGTEIARGLARMSAGDAARI
ARKKRDDAGDDVVVHRDDLVVLPSE
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgactgaccacgaggaacgcaccgccgcgaagggcgccgcgggccgccacgcggagggc
cccgcgcccgagctcgaccccgacggcgcgcgcgccgcgctcaagcgctgccgccgcatc
atcgtcaagatcggctcgaagagcctgtccggcgacgcctgggaccggctcgccgtcgag
gtggccgcgctccgcgcccgctccggccggaacctcgtcatcgtgtcgagcggcgccatc
gccctcggggtgacgaagctcggcctcaaggcgcggccgaaggacatggcctggctccag
gccgcggccgcggccggccagagcgtgctgatgcagcgctacgaggaggccttcggcaag
gtcggcctgcgcgtcgcgcaggtgctcctcacgcacgccgacctcgcggaccgcacccgc
accaacaacgcgaggaacgccctcgccgcgctgctcgaggccggcgccatcccgatcatc
aacgagaacgacgccgtcgcggtcgaggagatcaagttcggcgacaacgaccagctcgcg
gcgatggtcacgccgctctgcgaggccgatcttttgatcctcctctccgacgtcgagggc
ctgctcgacggcgacgggcgccgcgtgccgttcgtgcgcagcgtcgcccgcgaggcgcgg
cacctcgccggcggctcgacctccggcgtcggcaccggcggcatggccagcaaggtggag
gccgcgcggcgcgccacgctcgccggctcgcacgtggtcatcgccgccgcgcgcgagccg
ggcatcatcacgagcatcctctcgggcgaggacgtcggcaccctcttcgccgccgtgccg
cagcggctcagcgcgcgcaagcactggatcgcgtacacgctgcgcccgcgcggcgcgatc
ctcgtcgaccggggcgccgccgaggcgatcgcctcgaagaaccggagcatcctcgcggtc
ggcgtcctcggcgtgcgcggcaccttcctcccgggcgacgccgtggccgtcttcgacccg
gagggcaccgagatcgcgcgcgggctcgcgcggatgtccgccggcgacgccgcgcgcatc
gcgcggaagaagcgcgacgacgccggcgacgacgtcgtcgtccaccgcgacgacctcgtg
gtgctcccgagcgagtga

DBGET integrated database retrieval system