KEGG   Sorangium cellulosum So0157-2: SCE1572_48560Help
Entry
SCE1572_48560     CDS       T02718                                 

Definition
(GenBank) hypothetical protein
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
scu  Sorangium cellulosum So0157-2
Pathway
scu00330  Arginine and proline metabolism
scu00332  Carbapenem biosynthesis
scu01100  Metabolic pathways
scu01130  Biosynthesis of antibiotics
scu01230  Biosynthesis of amino acids
Module
scu_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:scu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SCE1572_48560
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    SCE1572_48560
Enzymes [BR:scu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SCE1572_48560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AGP41664
UniProt: S4Y9S9
Position
complement(13632919..13634076)
Genome map
AA seq 385 aa AA seqDB search
MTDHEERTAAKGAAGRHAEGPAPELDPDGARAALKRCRRIIVKIGSKSLSGDAWDRLAVE
VAALRARSGRNLVIVSSGAIALGVTKLGLKARPKDMAWLQAAAAAGQSVLMQRYEEAFGK
VGLRVAQVLLTHADLADRTRTNNARNALAALLEAGAIPIINENDAVAVEEIKFGDNDQLA
AMVTPLCEADLLILLSDVEGLLDGDGRRVPFVRSVAREARHLAGGSTSGVGTGGMASKVE
AARRATLAGSHVVIAAAREPGIITSILSGEDVGTLFAAVPQRLSARKHWIAYTLRPRGAI
LVDRGAAEAIASKNRSILAVGVLGVRGTFLPGDAVAVFDPEGTEIARGLARMSAGDAARI
ARKKRDDAGDDVVVHRDDLVVLPSE
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgactgaccacgaggaacgcaccgccgcgaagggcgccgcgggccgccacgcggagggc
cccgcgcccgagctcgaccccgacggcgcgcgcgccgcgctcaagcgctgccgccgcatc
atcgtcaagatcggctcgaagagcctgtccggcgacgcctgggaccggctcgccgtcgag
gtggccgcgctccgcgcccgctccggccggaacctcgtcatcgtgtcgagcggcgccatc
gccctcggggtgacgaagctcggcctcaaggcgcggccgaaggacatggcctggctccag
gccgcggccgcggccggccagagcgtgctgatgcagcgctacgaggaggccttcggcaag
gtcggcctgcgcgtcgcgcaggtgctcctcacgcacgccgacctcgcggaccgcacccgc
accaacaacgcgaggaacgccctcgccgcgctgctcgaggccggcgccatcccgatcatc
aacgagaacgacgccgtcgcggtcgaggagatcaagttcggcgacaacgaccagctcgcg
gcgatggtcacgccgctctgcgaggccgatcttttgatcctcctctccgacgtcgagggc
ctgctcgacggcgacgggcgccgcgtgccgttcgtgcgcagcgtcgcccgcgaggcgcgg
cacctcgccggcggctcgacctccggcgtcggcaccggcggcatggccagcaaggtggag
gccgcgcggcgcgccacgctcgccggctcgcacgtggtcatcgccgccgcgcgcgagccg
ggcatcatcacgagcatcctctcgggcgaggacgtcggcaccctcttcgccgccgtgccg
cagcggctcagcgcgcgcaagcactggatcgcgtacacgctgcgcccgcgcggcgcgatc
ctcgtcgaccggggcgccgccgaggcgatcgcctcgaagaaccggagcatcctcgcggtc
ggcgtcctcggcgtgcgcggcaccttcctcccgggcgacgccgtggccgtcttcgacccg
gagggcaccgagatcgcgcgcgggctcgcgcggatgtccgccggcgacgccgcgcgcatc
gcgcggaagaagcgcgacgacgccggcgacgacgtcgtcgtccaccgcgacgacctcgtg
gtgctcccgagcgagtga

DBGET integrated database retrieval system