KEGG   Streptomyces cattleya NRRL 8057 = DSM 46488: SCATT_00780Help
Entry
SCATT_00780       CDS       T02095                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
scy  Streptomyces cattleya NRRL 8057 = DSM 46488
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:scy00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
77230..79047
Genome map
AA seq 605 aa AA seqDB search
MGVEFAVFPDHPHGAALARGLQSASGGRSIAHPSGRPWIVGHWAEDAVVRASVGDRSAVV
FGMTDFDERSLAAGLATVVSTDETGALTGPLAGSHHLCLSVGGEVRLQGSLSGVREVYFA
EHHGVTVASGSAALAARLSGRGVDEERLALRLLAPDAPWPVGDESGWAGVTTLPVGHWLR
LARDGGGRVVRWWVPPEPRLPMAAAAAAVREALAEAVAVRTARGGVLSADLSGGLDSAGL
CFLAADGPARLVTLHALAVDAGNDDSAWAARSAERLGAARHVVVAADDGPRWFATPPCAD
GDLEGPVVLARTRAKAAHAVAHAAREGSRIHLTGIGGDELFTMRPALLHAMARAHPAVAV
RQLRATRTLGRWSLLTTARQVWGGGDYPRWLARCAERLTLTPGSSWVTGADWGVPPVMPP
WATPRATATARRLLAAAAEARPAPLAPLRVQHDMIRAVRAAGAAVRGLGHAVAGLQVAYE
APYLDDRVLDAALAVRLADRWALDHYKPVLAAALRGVVPGELLDRRTKGDYSAELFTGLR
RHRDDVLDVCAELADRGLVDGQALRAALTGLHPVTRGLLPLDATLSCATWLRAVGHDTAW
QGGAA
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
gtgggggtggagttcgcggtctttccggaccatccgcacggcgcggcgctggcgcggggg
ttgcagagcgcgagcggggggcggtcgatcgcccatccgtcgggcaggccctggatcgtg
gggcactgggccgaggacgcggtggtgcgcgcgtccgtcggtgaccggagcgccgtggtc
ttcggcatgacggacttcgacgagcggtcgctggcggcggggctggccaccgtggtctcc
accgacgagacaggcgcgctcaccggcccgttggccggcagccaccacctgtgtctgtcg
gtcggcggtgaagtgcgcctccagggcagcctgtcgggggtgcgcgaggtctacttcgcc
gagcaccacggggtgacggtggcctccggcagcgccgcgctggccgcccggctgtccggc
cgcggggtggacgaggaacggctggccctgcggctgctggcgccggacgcgccgtggccg
gtcggcgacgagagcggctgggccggggtcaccacgctgccggtcggccactggctgcgg
ctcgcccgggacggcggcggacgggtggtgcgctggtgggtgccgccggagccacggctg
ccgatggccgccgccgcggcggccgtacgggaagcgctggccgaggcggtcgcggtccgc
acggcacgcggcggggtgctcagcgccgacctgtccggcggtctggactcggccggcctg
tgcttcctggccgccgacggcccggcccggctggtcacgctgcacgcgctggcggtcgac
gccggcaacgacgacagcgcgtgggcggcccggtccgccgaacggctcggcgccgcgcgg
cacgtggtggtggccgccgacgacggcccccggtggttcgccacgccgccgtgcgccgac
ggtgatctggagggcccggtcgtgctggcccgcacccgggccaaggccgcccacgcggtg
gcccacgcggcgcgggagggctcccggatccatctcaccgggatcggcggtgacgagttg
ttcaccatgcgcccggcgttgctgcacgcgatggcgcgggcccatccggcggtggcggta
cggcagttgcgggccacccggacgctgggccggtggtcgctgctgaccaccgcgcgccag
gtatggggcggcggtgactacccgcgctggctggcgcgctgcgccgagcggctcacgctc
accccgggttcgtcctgggtcaccggtgccgactggggggtgcccccggtgatgccgccg
tgggcgacgccacgggccacggccaccgcgcgccggttgctggccgccgcggccgaggcc
cgtccggcaccgctggccccgctgcgggtgcagcacgacatgatccgcgcggtgcgcgcg
gccggcgcggcggtacgcggtctcggtcacgccgtcgccggcctccaggtcgcctacgag
gccccctacctcgacgaccgggtgctcgacgcggcgctggcggtgcggctggccgaccgc
tgggcgctggaccactacaaacccgtactggcggcggcgctgcgcggcgtcgtccccggc
gaactgctcgaccgccgtaccaagggcgactacagcgcggagctcttcaccgggctgcgc
cgccaccgggacgacgtgctcgacgtctgcgcggaactggccgaccggggcctggtggac
ggccaggcgctgcgcgcggcgctcaccgggctccatccggtgacccgggggctgctgccg
ctcgacgccacgttgtcctgcgccacctggctgcgggcggtcgggcacgacacggcgtgg
caaggaggtgcggcgtga

DBGET integrated database retrieval system